DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and EBF2

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_197917.1 Gene:EBF2 / 832607 AraportID:AT5G25350 Length:623 Species:Arabidopsis thaliana


Alignment Length:303 Identity:68/303 - (22%)
Similarity:133/303 - (43%) Gaps:55/303 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   384 LEALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQ 448
            :|.|.::.|..:|.:||:......:|  |.:|.::....:....:..:..|..|||.:|:.:|.:
plant   195 IEKLDLSRCPGITDSGLVAIAENCVN--LSDLTIDSCSGVGNEGLRAIARRCVNLRSISIRSCPR 257

  Fly   449 AVTDRTMATIC----QYQT--RLRNLNI---------EYCMKITD---QGLMGYGDTPYPI---- 491
             :.|:.:|.:.    .|.|  :|:.||:         .|...:||   .||.|..:..:.:    
plant   258 -IGDQGVAFLLAQAGSYLTKVKLQMLNVSGLSLAVIGHYGAAVTDLVLHGLQGVNEKGFWVMGNA 321

  Fly   492 SRLRGLKELNLRGCRNVTDSSL-MVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSS 555
            ..|:.||.|::..||.:||..| .||...|:|:.:||..|..::.:|..||.::..|||:|.:..
plant   322 KGLKKLKSLSVMSCRGMTDVGLEAVGNGCPDLKHVSLNKCLLVSGKGLVALAKSALSLESLKLEE 386

  Fly   556 CMAVDDETVLNIVSNL-KRLRVLNLSNCTKL---------------TLQSIHHILAHG------- 597
            |..::...::..:.|. .:|:..:|:||..:               :|:|:......|       
plant   387 CHRINQFGLMGFLMNCGSKLKAFSLANCLGISDFNSESSLPSPSCSSLRSLSIRCCPGFGDASLA 451

  Fly   598 ------HNLVQLIACSIDGMDHEQAQRILESQRPQMKQVLLXQ 634
                  |.|..:..|.::|:.....:.:|:|....:.:|.| :
plant   452 FLGKFCHQLQDVELCGLNGVTDAGVRELLQSNNVGLVKVNLSE 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381
LRR_RI <297..482 CDD:238064 26/115 (23%)
leucine-rich repeat 304..330 CDD:275381
leucine-rich repeat 331..357 CDD:275381
leucine-rich repeat 358..379 CDD:275381
leucine-rich repeat 384..409 CDD:275381 6/24 (25%)
leucine-rich repeat 412..437 CDD:275381 3/24 (13%)
AMN1 430..595 CDD:187754 50/203 (25%)
leucine-rich repeat 438..464 CDD:275381 8/31 (26%)
leucine-rich repeat 465..496 CDD:275381 10/46 (22%)
leucine-rich repeat 497..521 CDD:275381 10/24 (42%)
leucine-rich repeat 522..547 CDD:275381 7/24 (29%)
leucine-rich repeat 548..573 CDD:275381 5/25 (20%)
leucine-rich repeat 574..599 CDD:275381 7/52 (13%)
EBF2NP_197917.1 F-box 54..>92 CDD:279040
AMN1 <138..268 CDD:187754 17/75 (23%)
leucine-rich repeat 169..194 CDD:275381
leucine-rich repeat 195..220 CDD:275381 6/24 (25%)
leucine-rich repeat 221..246 CDD:275381 3/24 (13%)
leucine-rich repeat 247..278 CDD:275381 8/31 (26%)
leucine-rich repeat 279..326 CDD:275381 10/46 (22%)
leucine-rich repeat 327..352 CDD:275381 10/24 (42%)
leucine-rich repeat 353..378 CDD:275381 7/24 (29%)
leucine-rich repeat 379..402 CDD:275381 4/22 (18%)
leucine-rich repeat 406..459 CDD:275381 7/52 (13%)
leucine-rich repeat 407..433 CDD:275381 3/25 (12%)
AMN1 435..>582 CDD:187754 10/60 (17%)
leucine-rich repeat 460..511 CDD:275381 7/35 (20%)
leucine-rich repeat 487..512 CDD:275381 2/8 (25%)
leucine-rich repeat 514..537 CDD:275381
leucine-rich repeat 540..566 CDD:275381
leucine-rich repeat 567..595 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.