DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and VFB3

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_567316.1 Gene:VFB3 / 826171 AraportID:AT4G07400 Length:554 Species:Arabidopsis thaliana


Alignment Length:525 Identity:107/525 - (20%)
Similarity:183/525 - (34%) Gaps:135/525 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 HRRRF------MEKGKVIVTQHNLEAIHKHAKGGN------------CY-LSFERIELRNLRQCR 155
            ||||.      ..:.|...|...|..:.:...|.:            |. |.|:.:...:|::|.
plant    34 HRRRMGQSTSKFRRSKTTFTSPVLPNLREQNSGADEPYDYISNLPDECLSLIFQSLTCADLKRCS 98

  Fly   156 QL-ENFLRLVGHEVKHLQVRHAPVFRNLDGKLPNLKVLTIATTMSMDDQHLAAMDDLDMKQFSHL 219
            .: ..:|.:.|      |.||     .|..|..:..:..|.:..:..|    ::..|.::.....
plant    99 LVCRRWLTIEG------QCRH-----RLSLKAQSDLISVIPSLFTRFD----SVTKLVLRSDRRS 148

  Fly   220 VGFECDGVSLDAVLKMRMLLQLRR--------------TENKVQLRHLQF---EFRRNNENALLD 267
            :|. ||...:...::.|.|.:|:.              |||...|:.:.|   .|.....||||:
plant   149 LGI-CDNAFVMISVRCRNLTRLKLRGCPEISDLGIIGFTENCRSLKKVSFGSCGFGVKGMNALLN 212

  Fly   268 VLQDHAETLVCVNLFFSCSPGIDTREWCRAFENMHNLRTLKLSGNCHLV--------LLEAVLRA 324
            .                          |...|.:...|...:.....|:        |....|:.
plant   213 T--------------------------CLGLEELSVKRLRGIGAGAELIGPGGAAGSLKVICLKE 251

  Fly   325 VPES---APIRQLDLTGMLSLTNELLLYVAGKWQSTLKVLDLMF-CVQLNANCIDALRQLSGRLE 385
            :...   ||:    |:|...|....:...:|.|       |.:| .|:...|.|..:     .||
plant   252 LHNGQCFAPL----LSGAKGLRILKIFRCSGDW-------DRVFEAVRDKVNAIVEI-----HLE 300

  Fly   386 ALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCR-QA 449
            .:.|:   :| |...|...:|     ::.|||.:|.......:..:.||...||:|.:|..: ..
plant   301 RIQMS---DL-GLTALSKCSG-----VEVLHLVKTPDCTNVGLALVAERCKLLRKLHIDGWKTNR 356

  Fly   450 VTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYP----ISRLRGLKELNLRGCRNVTD 510
            :.|..:..:.           :||..:.:..|:|...|...    :|....|:.|.|.|...|.|
plant   357 IGDEGLIVVA-----------KYCWNLQELVLIGVNPTKLSLEAIVSNCLNLERLALCGSDTVGD 410

  Fly   511 SSL-MVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNIVSNLKRL 574
            :.| .:..|...||.|.:..| .:|.:|.:||...||:|..:.|..|..|..:.. :::...:.|
plant   411 TELCCIAEKCLALRKLCIKNC-PITDDGIKALGNGCPNLLKVKVKKCRGVTTQGA-DLLRKRRAL 473

  Fly   575 RVLNL 579
            .|:||
plant   474 LVVNL 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040 4/12 (33%)
leucine-rich repeat 281..303 CDD:275381 2/21 (10%)
LRR_RI <297..482 CDD:238064 37/197 (19%)
leucine-rich repeat 304..330 CDD:275381 4/36 (11%)
leucine-rich repeat 331..357 CDD:275381 5/25 (20%)
leucine-rich repeat 358..379 CDD:275381 5/21 (24%)
leucine-rich repeat 384..409 CDD:275381 7/24 (29%)
leucine-rich repeat 412..437 CDD:275381 6/24 (25%)
AMN1 430..595 CDD:187754 39/156 (25%)
leucine-rich repeat 438..464 CDD:275381 5/26 (19%)
leucine-rich repeat 465..496 CDD:275381 6/34 (18%)
leucine-rich repeat 497..521 CDD:275381 8/24 (33%)
leucine-rich repeat 522..547 CDD:275381 9/24 (38%)
leucine-rich repeat 548..573 CDD:275381 4/24 (17%)
leucine-rich repeat 574..599 CDD:275381 4/6 (67%)
VFB3NP_567316.1 F-box-like 74..>104 CDD:289689 5/29 (17%)
leucine-rich repeat 89..114 CDD:275381 7/35 (20%)
leucine-rich repeat 115..165 CDD:275381 8/54 (15%)
AMN1 <146..>226 CDD:187754 19/106 (18%)
leucine-rich repeat 166..191 CDD:275381 5/24 (21%)
leucine-rich repeat 192..216 CDD:275381 8/49 (16%)
leucine-rich repeat 268..293 CDD:275381 6/31 (19%)
leucine-rich repeat 294..317 CDD:275381 7/31 (23%)
leucine-rich repeat 318..343 CDD:275381 6/24 (25%)
AMN1 <340..>463 CDD:187754 34/134 (25%)
leucine-rich repeat 344..371 CDD:275381 7/37 (19%)
leucine-rich repeat 372..396 CDD:275381 4/23 (17%)
leucine-rich repeat 397..422 CDD:275381 8/24 (33%)
leucine-rich repeat 423..447 CDD:275381 9/24 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.