DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and AT4G03630

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_192272.1 Gene:AT4G03630 / 825663 AraportID:AT4G03630 Length:220 Species:Arabidopsis thaliana


Alignment Length:234 Identity:61/234 - (26%)
Similarity:96/234 - (41%) Gaps:56/234 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 NELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTGLLQGLAGDI 408
            :|||.:||.: .|.||.|..|.|                ...||:...|                
plant     9 DELLTFVAYR-SSILKRLGRMMC----------------HAVALSQGGC---------------- 40

  Fly   409 NYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNLNIEYC 473
                .|:::|.  |..:|.:..:.:|..|||.|.|..|.| :|...:.|.......|.:|.:.||
plant    41 ----VEINIEH--FGTDSLLTYIADRSSNLRHLGLAKCDQ-ITGMGLFTEAMKLPLLEDLELSYC 98

  Fly   474 MKITDQGLMGYGDTPYPISRLRGLKELNLRGCR----NVTDSSLMVGLKLPELRALSLGYCNRLT 534
            : |..:.|...|   :....|:.|| ||.:|.:    .....:|.:..::||||.|.| :.||::
plant    99 L-IKGKNLEAIG---FACLHLKTLK-LNCQGFKFPGFTYDHDALGIAKRMPELRCLQL-FGNRVS 157

  Fly   535 SEGFEALTQNCPSLEALCVSSCMAVDDETVLNIVSNLKR 573
            ..|..|:...||.||.|.:..|..:      |:|.:|::
plant   158 DVGLNAIFDGCPHLEHLDLRQCFNI------NLVGDLEK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381
LRR_RI <297..482 CDD:238064 33/137 (24%)
leucine-rich repeat 304..330 CDD:275381
leucine-rich repeat 331..357 CDD:275381 5/12 (42%)
leucine-rich repeat 358..379 CDD:275381 5/20 (25%)
leucine-rich repeat 384..409 CDD:275381 3/24 (13%)
leucine-rich repeat 412..437 CDD:275381 5/24 (21%)
AMN1 430..595 CDD:187754 43/148 (29%)
leucine-rich repeat 438..464 CDD:275381 8/25 (32%)
leucine-rich repeat 465..496 CDD:275381 8/30 (27%)
leucine-rich repeat 497..521 CDD:275381 6/27 (22%)
leucine-rich repeat 522..547 CDD:275381 9/24 (38%)
leucine-rich repeat 548..573 CDD:275381 7/24 (29%)
leucine-rich repeat 574..599 CDD:275381 61/234 (26%)
AT4G03630NP_192272.1 AMN1 <39..179 CDD:187754 44/168 (26%)
leucine-rich repeat 64..89 CDD:275381 8/25 (32%)
leucine-rich repeat 90..114 CDD:275381 7/27 (26%)
leucine-rich repeat 115..145 CDD:275381 7/30 (23%)
leucine-rich repeat 146..170 CDD:275381 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.