DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and AT3G07550

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_566312.1 Gene:AT3G07550 / 819944 AraportID:AT3G07550 Length:395 Species:Arabidopsis thaliana


Alignment Length:421 Identity:93/421 - (22%)
Similarity:147/421 - (34%) Gaps:149/421 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 LQFEFRRNNENALLDVLQDHAETLVCVNLFFSCSPGIDTREWCRAFENMHNLRTLKLSGNCHLVL 317
            |.|.|:|      ||.:.||.            |.|:....|.    |:.|:....|...|...:
plant    23 LSFIFQR------LDSVADHD------------SFGLTCHRWL----NIQNISRRSLQFQCSFSV 65

  Fly   318 LEAVLRAVPESAPIRQLDLTGMLSLTNELL-------LYVAGKWQSTLKVLDLMFCVQLNANCID 375
            |.      |.|           ||.||..:       |....:|   |:.|.|..|..||.:.:|
plant    66 LN------PSS-----------LSQTNPDVSSHHLHRLLTRFQW---LEHLSLSGCTVLNDSSLD 110

  Fly   376 ALRQLSGRLEALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRR 440
            :||....||..|.:..|..::..|:                  .||    :|.|      |||..
plant   111 SLRYPGARLHTLYLDCCFGISDDGI------------------STI----ASFC------PNLSV 147

  Fly   441 LSLDNCRQAVTDRTMATICQYQTRLRNLNIEYCMKITDQGL------------------------ 481
            :||..|.  ::|..:.|:.:....|:.:|:.||..::|.|:                        
plant   148 VSLYRCN--ISDIGLETLARASLSLKCVNLSYCPLVSDFGIKALSQACLQLESVKISNCKSITGV 210

  Fly   482 --------MGYGDT------PYPIS--------------------RLRG-----------LKELN 501
                    :||.|.      |..|:                    |..|           |:.||
plant   211 GFSGCSPTLGYVDADSCQLEPKGITGIISGGGIEFLNISGVSCYIRKDGLVPIGSGIASKLRILN 275

  Fly   502 LRGCRNVTDSSL-MVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVL 565
            ||.||.|.|.|: .:....|.|:..:|..|:.:...|:||:.:.|.:|:.|.|:.|..:.|:.:|
plant   276 LRMCRTVGDESIEAIAKGCPLLQEWNLALCHEVKISGWEAVGKWCRNLKKLHVNRCRNLCDQGLL 340

  Fly   566 NIVSNLKRLRVLNLSNCTKLTLQSIHHILAH 596
            .:......|::|.::...:||..:|.....|
plant   341 ALRCGCMNLQILYMNGNARLTPTAIEMFRLH 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 4/21 (19%)
LRR_RI <297..482 CDD:238064 45/223 (20%)
leucine-rich repeat 304..330 CDD:275381 5/25 (20%)
leucine-rich repeat 331..357 CDD:275381 6/32 (19%)
leucine-rich repeat 358..379 CDD:275381 8/20 (40%)
leucine-rich repeat 384..409 CDD:275381 4/24 (17%)
leucine-rich repeat 412..437 CDD:275381 4/24 (17%)
AMN1 430..595 CDD:187754 50/234 (21%)
leucine-rich repeat 438..464 CDD:275381 6/25 (24%)
leucine-rich repeat 465..496 CDD:275381 12/88 (14%)
leucine-rich repeat 497..521 CDD:275381 10/24 (42%)
leucine-rich repeat 522..547 CDD:275381 7/24 (29%)
leucine-rich repeat 548..573 CDD:275381 6/24 (25%)
leucine-rich repeat 574..599 CDD:275381 6/23 (26%)
AT3G07550NP_566312.1 leucine-rich repeat 93..118 CDD:275381 9/24 (38%)
leucine-rich repeat 119..144 CDD:275381 8/52 (15%)
AMN1 142..361 CDD:187754 48/226 (21%)
leucine-rich repeat 145..169 CDD:275381 6/25 (24%)
leucine-rich repeat 170..195 CDD:275381 6/24 (25%)
leucine-rich repeat 196..270 CDD:275381 7/73 (10%)
leucine-rich repeat 271..296 CDD:275381 10/24 (42%)
leucine-rich repeat 297..322 CDD:275381 7/24 (29%)
leucine-rich repeat 323..346 CDD:275381 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.