DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and AT2G36370

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_565845.3 Gene:AT2G36370 / 818210 AraportID:AT2G36370 Length:940 Species:Arabidopsis thaliana


Alignment Length:561 Identity:123/561 - (21%)
Similarity:210/561 - (37%) Gaps:163/561 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 NLRQCRQLENFLRLVGHEVKHL-QVRHAPVFRNLDGKLPNLKVLTIATTMSMDDQHLAAMDDLDM 213
            |||..:.||:||:....:.:|. |:.|              :.|.|.:..|:.:..::....||.
plant   336 NLRWRKSLESFLKNPDDDERHQEQISH--------------RTLPILSFESVKEIDISKCQRLDY 386

  Fly   214 KQFSHLVGFECDGVSLDAVLKMR--MLLQLRRTENKVQLRHLQFEFRRNNENALLDVLQDHAETL 276
            |     |..:|...|..::.|:|  .||.::                   .:.||::|.:..| |
plant   387 K-----VVIKCFSKSFPSLRKLRAAYLLNIK-------------------VSTLLELLLNFRE-L 426

  Fly   277 VCVNLFFSCSPGIDTREWCRAFENMHNLRTLKLSGNCHLVLLEAVLRAVPESAPIRQLDLTGMLS 341
            ..|:|....||.|..:            .::..||..|.:|           :.|.:|.|.|...
plant   427 TEVDLTVDVSPIIPVQ------------ASVFYSGQGHCLL-----------SSITRLTLEGRSD 468

  Fly   342 LTNELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAY-----------CREL 395
            :.:..|..::...:| |..|::..|..|:..||.::.|...:|.:|.:.|           |..:
plant   469 ICDMELRSISRVCES-LCYLNIKGCALLSDACIASVIQRCKKLCSLIVCYTSFSENSILALCATI 532

  Fly   396 TGTGLLQGLAGDIN---YSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQAVTDRTMAT 457
            :.|....    |||   .:||.||:.:...:.|:|:..|:.....::.|.|.:.:  |:|   :.
plant   533 SMTNEHM----DINSVASNLQTLHMSKCEGISETSLLNLITHSQKMKSLCLRDTK--VSD---SV 588

  Fly   458 ICQYQ-TRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNV--------TDS-- 511
            :|::. :.|..|:|..    |....|.....   |||...||.|..|||:|:        ||:  
plant   589 LCEFPGSTLEALDISN----TTISWMALARV---ISRNPNLKTLKARGCKNLLQLEVDGRTDNFS 646

  Fly   512 ----------SLMVGLKLPE---------------------LRALSLGYCNRLTSEGFEALTQNC 545
                      .|..|..|.|                     ||.:|:|....|..:..:.|...|
plant   647 PLVSGQEVFKCLSKGSGLEELEIGWGFSYFSFESLRPAASFLRVISVGLGASLGEDVLKLLPSTC 711

  Fly   546 PSLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSNC----------------TKLTLQSIHHIL 594
            |.||:: |.....:.|..:.:::::||.|:.|.||.|                .||.|:.:...:
plant   712 PLLESI-VLHFQEISDSALTSVLTSLKHLQELALSYCFGEISLQSFKFSMPNLRKLRLERVTRWM 775

  Fly   595 AHGHNLVQLIAC------SIDGMDH--EQAQRILESQRPQM 627
            .:...||...:|      |:.|..|  ...|.|:.:..|.|
plant   776 TNDDLLVLTQSCPNLTELSLVGCLHLTSDCQPIISAGWPGM 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 4/21 (19%)
LRR_RI <297..482 CDD:238064 41/199 (21%)
leucine-rich repeat 304..330 CDD:275381 4/25 (16%)
leucine-rich repeat 331..357 CDD:275381 5/25 (20%)
leucine-rich repeat 358..379 CDD:275381 6/20 (30%)
leucine-rich repeat 384..409 CDD:275381 6/35 (17%)
leucine-rich repeat 412..437 CDD:275381 7/24 (29%)
AMN1 430..595 CDD:187754 49/222 (22%)
leucine-rich repeat 438..464 CDD:275381 5/26 (19%)
leucine-rich repeat 465..496 CDD:275381 8/30 (27%)
leucine-rich repeat 497..521 CDD:275381 12/43 (28%)
leucine-rich repeat 522..547 CDD:275381 7/24 (29%)
leucine-rich repeat 548..573 CDD:275381 5/24 (21%)
leucine-rich repeat 574..599 CDD:275381 8/40 (20%)
AT2G36370NP_565845.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.