DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and kdm2ab

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:XP_001339797.3 Gene:kdm2ab / 799441 ZFINID:ZDB-GENE-101007-5 Length:1263 Species:Danio rerio


Alignment Length:320 Identity:72/320 - (22%)
Similarity:121/320 - (37%) Gaps:93/320 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 AETLVCVNLFFSCSP----GIDTREWCRAFENMHNLRTLKLSGNCHLVLLEAVLRAVPESAPIRQ 333
            ||..||:.:   |..    |.|.|.|.|.        :|..|.:....:|..:::..|.:     
Zfish  1014 AELCVCMAV---CKSWYKWGCDKRLWTRI--------SLSRSRSMSPQVLTGIIKRQPVT----- 1062

  Fly   334 LDLTGMLSLTNELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRL---------EALTM 389
            |||: ..::|.:.|.::..:... ||.|.|..|   |.:.:.||...|..|         :.:..
Zfish  1063 LDLS-WANITKKQLSWLINRLPG-LKDLVLSGC---NWSSVSALSSPSCPLLRSLDLSWADGIKD 1122

  Fly   390 AYCRELTGTGLLQGLAGDINYSLQELH------LEETIFLDESSMCQLLERLPNLRRLSLDNCRQ 448
            |..||     ||.....|....::.:.      ||.|    |:::..::..:|.|.||.|..|  
Zfish  1123 AQIRE-----LLNPPGSDNRSQMKNMQCLWLCGLEVT----EATLRLIIRHMPLLTRLELSRC-- 1176

  Fly   449 AVTDRTMATICQYQTRLRN----LNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVT 509
            .:||..:..:....:..||    ||:..|.::||:.|:      | :.||..|..|:||.|:.| 
Zfish  1177 PITDGALNLLSAVGSSTRNTLTHLNLAGCTQLTDRCLV------Y-LRRLSCLSILDLRDCKGV- 1233

  Fly   510 DSSLMVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNIVS 569
                            |:..|....||              |.|::...:.|:.::..:|
Zfish  1234 ----------------SVQACQSFISE--------------LSVNTLYYLSDDKLIERIS 1263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 6/25 (24%)
LRR_RI <297..482 CDD:238064 44/203 (22%)
leucine-rich repeat 304..330 CDD:275381 4/25 (16%)
leucine-rich repeat 331..357 CDD:275381 5/25 (20%)
leucine-rich repeat 358..379 CDD:275381 8/20 (40%)
leucine-rich repeat 384..409 CDD:275381 7/33 (21%)
leucine-rich repeat 412..437 CDD:275381 4/30 (13%)
AMN1 430..595 CDD:187754 33/144 (23%)
leucine-rich repeat 438..464 CDD:275381 7/25 (28%)
leucine-rich repeat 465..496 CDD:275381 11/34 (32%)
leucine-rich repeat 497..521 CDD:275381 6/23 (26%)
leucine-rich repeat 522..547 CDD:275381 4/24 (17%)
leucine-rich repeat 548..573 CDD:275381 4/22 (18%)
leucine-rich repeat 574..599 CDD:275381
kdm2abXP_001339797.3 JmjC 150..221 CDD:214721
cupin_like 197..297 CDD:304367
zf-CXXC <524..558 CDD:251032
PHD_4 563..624 CDD:293471
F-box-like 1002..1042 CDD:289689 10/38 (26%)
leucine-rich repeat 1036..1060 CDD:275381 5/31 (16%)
leucine-rich repeat 1061..1084 CDD:275381 5/28 (18%)
AMN1 1075..1230 CDD:187754 44/176 (25%)
leucine-rich repeat 1085..1108 CDD:275381 9/25 (36%)
leucine-rich repeat 1109..1142 CDD:275381 6/37 (16%)
leucine-rich repeat 1143..1167 CDD:275381 4/27 (15%)
leucine-rich repeat 1197..1216 CDD:275381 7/25 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.