DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and amn1

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001038919.1 Gene:amn1 / 751744 ZFINID:ZDB-GENE-060825-13 Length:249 Species:Danio rerio


Alignment Length:195 Identity:52/195 - (26%)
Similarity:89/195 - (45%) Gaps:34/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   427 SMCQLLERLPNLRRLSLDNCRQAVTDRTMATICQYQT------------RLRNLNIEYCMKITDQ 479
            |:.|..|:..::|.|.     .:|.||.:..:..|.|            ....|:::.| ||:|.
Zfish    14 SVAQRAEKYEDIRMLP-----ASVKDRLLRIMTSYGTVTDSNISQLVHSGTHTLDLQNC-KISDS 72

  Fly   480 GLMGYGDTPYPISRLRGLKELNLRGCRNVTDSSL-MVGLKLPELRALSLGYCNRLTSEGFEALTQ 543
            .|.       .|:.|. |:.:.||||..:|...| ::..:.|.|:.:.|..|..:|..|.:||.:
Zfish    73 ALK-------QINSLH-LRTILLRGCAEITSEGLEVLAPRCPYLQVVDLTGCTAVTDSGIQALAR 129

  Fly   544 NCPSLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNLVQLIACSI 608
            :|..||.:.:..|.|:.|:.:|.:..|.|.|..:..|. |::|.|.:.. ||.|     :.:||:
Zfish   130 HCKCLEVISLRGCSALSDKALLELGGNCKMLHSIYFSG-TEVTDQGVIG-LATG-----VCSCSL 187

  Fly   609  608
            Zfish   188  187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381
LRR_RI <297..482 CDD:238064 15/66 (23%)
leucine-rich repeat 304..330 CDD:275381
leucine-rich repeat 331..357 CDD:275381
leucine-rich repeat 358..379 CDD:275381
leucine-rich repeat 384..409 CDD:275381
leucine-rich repeat 412..437 CDD:275381 3/9 (33%)
AMN1 430..595 CDD:187754 46/177 (26%)
leucine-rich repeat 438..464 CDD:275381 7/37 (19%)
leucine-rich repeat 465..496 CDD:275381 8/30 (27%)
leucine-rich repeat 497..521 CDD:275381 7/24 (29%)
leucine-rich repeat 522..547 CDD:275381 8/24 (33%)
leucine-rich repeat 548..573 CDD:275381 7/24 (29%)
leucine-rich repeat 574..599 CDD:275381 8/24 (33%)
amn1NP_001038919.1 AMN1 33..248 CDD:187754 46/171 (27%)
leucine-rich repeat 59..72 CDD:275381 4/13 (31%)
leucine-rich repeat 82..107 CDD:275381 7/24 (29%)
leucine-rich repeat 108..133 CDD:275381 8/24 (33%)
leucine-rich repeat 134..159 CDD:275381 7/24 (29%)
leucine-rich repeat 160..186 CDD:275381 8/32 (25%)
leucine-rich repeat 187..212 CDD:275381 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.