Sequence 1: | NP_001303481.1 | Gene: | CG12402 / 41714 | FlyBaseID: | FBgn0038202 | Length: | 671 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_848739.1 | Gene: | Fbxl2 / 72179 | MGIID: | 1919429 | Length: | 423 | Species: | Mus musculus |
Alignment Length: | 380 | Identity: | 102/380 - (26%) |
---|---|---|---|
Similarity: | 161/380 - (42%) | Gaps: | 98/380 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 296 RAFENMHN-----LRTLKLSGNCHLVLLEAVLRAVPESA-PIRQLDLTGMLSLTNELLLYVAGKW 354
Fly 355 QSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTG---LLQGLAGDINYSLQELH 416
Fly 417 LEETIFLDESSMCQLLERLPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNLNIEYCMKITDQGL 481
Fly 482 MGYGDTPYPISRLRG---LKELNLRGCRNVTDSSL-MVGLKLPELRALSLGYCNRLTSEGFEALT 542
Fly 543 QN--------------------------CPSLEALCVSSCMAVDDETVLNIVSNL---KRLRVLN 578
Fly 579 LSNCTKLTLQSIHHI-LAHGHNLVQLIACSIDGMDHEQAQRI----LESQRPQMK 628 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12402 | NP_001303481.1 | F-box | 75..117 | CDD:279040 | |
leucine-rich repeat | 281..303 | CDD:275381 | 3/6 (50%) | ||
LRR_RI | <297..482 | CDD:238064 | 47/193 (24%) | ||
leucine-rich repeat | 304..330 | CDD:275381 | 7/26 (27%) | ||
leucine-rich repeat | 331..357 | CDD:275381 | 6/25 (24%) | ||
leucine-rich repeat | 358..379 | CDD:275381 | 7/20 (35%) | ||
leucine-rich repeat | 384..409 | CDD:275381 | 9/27 (33%) | ||
leucine-rich repeat | 412..437 | CDD:275381 | 0/24 (0%) | ||
AMN1 | 430..595 | CDD:187754 | 61/198 (31%) | ||
leucine-rich repeat | 438..464 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 465..496 | CDD:275381 | 8/30 (27%) | ||
leucine-rich repeat | 497..521 | CDD:275381 | 12/24 (50%) | ||
leucine-rich repeat | 522..547 | CDD:275381 | 10/50 (20%) | ||
leucine-rich repeat | 548..573 | CDD:275381 | 9/27 (33%) | ||
leucine-rich repeat | 574..599 | CDD:275381 | 11/25 (44%) | ||
Fbxl2 | NP_848739.1 | F-box-like | 15..57 | CDD:289689 | |
leucine-rich repeat | 52..79 | CDD:275381 | 3/11 (27%) | ||
LRR 1 | 61..87 | 7/19 (37%) | |||
AMN1 | <76..223 | CDD:187754 | 42/181 (23%) | ||
leucine-rich repeat | 80..99 | CDD:275381 | 7/20 (35%) | ||
Interaction with Calmodulin. /evidence=ECO:0000269|PubMed:21343341 | 80..90 | 6/11 (55%) | |||
LRR 2 | 88..113 | 5/25 (20%) | |||
leucine-rich repeat | 106..131 | CDD:275381 | 6/25 (24%) | ||
LRR 3 | 114..139 | 8/25 (32%) | |||
leucine-rich repeat | 132..157 | CDD:275381 | 7/24 (29%) | ||
LRR 4 | 140..165 | 5/24 (21%) | |||
leucine-rich repeat | 158..183 | CDD:275381 | 8/24 (33%) | ||
LRR 5 | 166..191 | 9/55 (16%) | |||
AMN1 | 168..367 | CDD:187754 | 66/239 (28%) | ||
leucine-rich repeat | 184..209 | CDD:275381 | 7/25 (28%) | ||
LRR 6 | 192..217 | 7/25 (28%) | |||
leucine-rich repeat | 210..235 | CDD:275381 | 10/33 (30%) | ||
LRR 7 | 218..243 | 10/33 (30%) | |||
leucine-rich repeat | 236..261 | CDD:275381 | 12/24 (50%) | ||
LRR 8 | 244..269 | 11/24 (46%) | |||
leucine-rich repeat | 262..287 | CDD:275381 | 9/24 (38%) | ||
LRR 9 | 270..295 | 7/24 (29%) | |||
leucine-rich repeat | 288..313 | CDD:275381 | 1/24 (4%) | ||
LRR 10 | 296..321 | 5/24 (21%) | |||
leucine-rich repeat | 314..336 | CDD:275381 | 8/21 (38%) | ||
LRR 11 | 322..350 | 11/27 (41%) | |||
leucine-rich repeat | 343..362 | CDD:275381 | 9/18 (50%) | ||
LRR 12 | 351..375 | 6/23 (26%) | |||
LRR 13 | 376..401 | 6/27 (22%) | |||
CAAX motif | 420..423 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR13318 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |