DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and Fbxl15

DIOPT Version :10

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001365702.1 Gene:Fbxl15 / 68431 MGIID:1915681 Length:336 Species:Mus musculus


Alignment Length:219 Identity:54/219 - (24%)
Similarity:91/219 - (41%) Gaps:45/219 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   377 LRQLSGRLEALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRL 441
            ||...| |:.|.:|.|.|                           :|.:..:..:|.|.|.||.:
Mouse   119 LRDAEG-LQELALAPCHE---------------------------WLSDEDLVPVLARNPQLRSV 155

  Fly   442 SLDNCRQAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCR 506
            :|..|.| ::.|.:..:.:...||:.|::.:|..:....|.|..|      |...|:||:|..||
Mouse   156 ALAGCGQ-LSRRALGALAEGCPRLQRLSLAHCDWVDGLALRGLAD------RCPALEELDLTACR 213

  Fly   507 NVTDSSL--MVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNIVS 569
            .:.|.::  :...:...||:|||.....:.....:.|.:|||.||.|.::.|:.|..:.|..:..
Mouse   214 QLKDEAIVYLAQRRGAGLRSLSLAVNANVGDTAVQELARNCPQLEHLDLTGCLRVGSDGVRTLAE 278

  Fly   570 NLKRLRVLNLSNCTKLTLQSIHHI 593
            ....||.|.:.:|        ||:
Mouse   279 YCPALRSLRVRHC--------HHV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:425796
leucine-rich repeat 281..303 CDD:275381
PPP1R42 <297..482 CDD:455733 22/104 (21%)
leucine-rich repeat 304..330 CDD:275381
leucine-rich repeat 331..357 CDD:275381
leucine-rich repeat 358..379 CDD:275381 1/1 (100%)
leucine-rich repeat 384..409 CDD:275381 5/24 (21%)
leucine-rich repeat 412..437 CDD:275381 3/24 (13%)
AMN1 430..595 CDD:187754 45/166 (27%)
leucine-rich repeat 438..464 CDD:275381 6/25 (24%)
leucine-rich repeat 465..496 CDD:275381 7/30 (23%)
leucine-rich repeat 497..521 CDD:275381 7/25 (28%)
leucine-rich repeat 522..547 CDD:275381 8/24 (33%)
leucine-rich repeat 548..573 CDD:275381 6/24 (25%)
leucine-rich repeat 574..599 CDD:275381 6/20 (30%)
Fbxl15NP_001365702.1 F-box_FBXL15 19..62 CDD:438898
FBXL3_LRR-like <107..182 CDD:480268 20/91 (22%)
leucine-rich repeat 125..151 CDD:275381 8/52 (15%)
leucine-rich repeat 152..177 CDD:275381 6/25 (24%)
AMN1 <175..>304 CDD:187754 36/134 (27%)
leucine-rich repeat 178..203 CDD:275381 7/30 (23%)
leucine-rich repeat 204..230 CDD:275381 7/25 (28%)
leucine-rich repeat 231..256 CDD:275381 8/24 (33%)
leucine-rich repeat 257..281 CDD:275381 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.