Sequence 1: | NP_001303481.1 | Gene: | CG12402 / 41714 | FlyBaseID: | FBgn0038202 | Length: | 671 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001365702.1 | Gene: | Fbxl15 / 68431 | MGIID: | 1915681 | Length: | 336 | Species: | Mus musculus |
Alignment Length: | 219 | Identity: | 54/219 - (24%) |
---|---|---|---|
Similarity: | 91/219 - (41%) | Gaps: | 45/219 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 377 LRQLSGRLEALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRL 441
Fly 442 SLDNCRQAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCR 506
Fly 507 NVTDSSL--MVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNIVS 569
Fly 570 NLKRLRVLNLSNCTKLTLQSIHHI 593 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12402 | NP_001303481.1 | F-box | 75..117 | CDD:279040 | |
leucine-rich repeat | 281..303 | CDD:275381 | |||
LRR_RI | <297..482 | CDD:238064 | 22/104 (21%) | ||
leucine-rich repeat | 304..330 | CDD:275381 | |||
leucine-rich repeat | 331..357 | CDD:275381 | |||
leucine-rich repeat | 358..379 | CDD:275381 | 1/1 (100%) | ||
leucine-rich repeat | 384..409 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 412..437 | CDD:275381 | 3/24 (13%) | ||
AMN1 | 430..595 | CDD:187754 | 45/166 (27%) | ||
leucine-rich repeat | 438..464 | CDD:275381 | 6/25 (24%) | ||
leucine-rich repeat | 465..496 | CDD:275381 | 7/30 (23%) | ||
leucine-rich repeat | 497..521 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 522..547 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 548..573 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 574..599 | CDD:275381 | 6/20 (30%) | ||
Fbxl15 | NP_001365702.1 | F-box | 18..55 | CDD:395521 | |
leucine-rich repeat | 125..151 | CDD:275381 | 8/52 (15%) | ||
leucine-rich repeat | 152..177 | CDD:275381 | 6/25 (24%) | ||
AMN1 | <175..>304 | CDD:187754 | 36/134 (27%) | ||
leucine-rich repeat | 178..203 | CDD:275381 | 7/30 (23%) | ||
leucine-rich repeat | 204..230 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 231..256 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 257..281 | CDD:275381 | 6/23 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR13318 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |