DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and FBXL17

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:XP_005272105.1 Gene:FBXL17 / 64839 HGNCID:13615 Length:712 Species:Homo sapiens


Alignment Length:318 Identity:71/318 - (22%)
Similarity:137/318 - (43%) Gaps:64/318 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 PESAPIRQLDLTGMLSLTNELLL--------YVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSG 382
            ||:..|.||..:.:|.:.:.|.|        .|...|:..  .||..|..||:         ||.
Human   316 PETPDINQLPPSILLKIFSNLSLDERCLSASLVCKYWRDL--CLDFQFWKQLD---------LSS 369

  Fly   383 RLEALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCR 447
            |         :::|.. ||:.:|.. :.::.|:::.:...:.::.:|.|..:.|.|.|.:...|:
Human   370 R---------QQVTDE-LLEKIASR-SQNIIEINISDCRSMSDNGVCVLAFKCPGLLRYTAYRCK 423

  Fly   448 QAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVTDSS 512
            | ::|.::..:..:...|:.:::....|:||:||...|      |:.|.||:::...|..::|..
Human   424 Q-LSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLG------SKCRELKDIHFGQCYKISDEG 481

  Fly   513 LMVGLK-LPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMA------------------ 558
            ::|..| ..:|:.:.:.....:|.:..:|..::||.|:.:....|..                  
Human   482 MIVIAKGCLKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSLD 546

  Fly   559 ------VDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNL--VQLIACSI 608
                  :|:|||:.||...|.|..|||.....:..:.:..|...|.||  :.|::|.|
Human   547 LRHITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLVSCKI 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381
LRR_RI <297..482 CDD:238064 36/163 (22%)
leucine-rich repeat 304..330 CDD:275381 2/3 (67%)
leucine-rich repeat 331..357 CDD:275381 8/33 (24%)
leucine-rich repeat 358..379 CDD:275381 5/20 (25%)
leucine-rich repeat 384..409 CDD:275381 4/24 (17%)
leucine-rich repeat 412..437 CDD:275381 3/24 (13%)
AMN1 430..595 CDD:187754 41/189 (22%)
leucine-rich repeat 438..464 CDD:275381 5/25 (20%)
leucine-rich repeat 465..496 CDD:275381 8/30 (27%)
leucine-rich repeat 497..521 CDD:275381 6/24 (25%)
leucine-rich repeat 522..547 CDD:275381 4/24 (17%)
leucine-rich repeat 548..573 CDD:275381 8/48 (17%)
leucine-rich repeat 574..599 CDD:275381 6/24 (25%)
FBXL17XP_005272105.1 F-box-like 321..368 CDD:289689 13/57 (23%)
leucine-rich repeat 362..387 CDD:275381 9/44 (20%)
leucine-rich repeat 388..413 CDD:275381 3/24 (13%)
AMN1 411..573 CDD:187754 37/168 (22%)
leucine-rich repeat 414..439 CDD:275381 5/25 (20%)
leucine-rich repeat 440..465 CDD:275381 8/30 (27%)
leucine-rich repeat 466..491 CDD:275381 6/24 (25%)
leucine-rich repeat 492..517 CDD:275381 4/24 (17%)
leucine-rich repeat 518..541 CDD:275381 2/22 (9%)
leucine-rich repeat 542..567 CDD:275381 6/24 (25%)
AMN1 547..>652 CDD:187754 18/58 (31%)
leucine-rich repeat 568..593 CDD:275381 6/24 (25%)
leucine-rich repeat 594..615 CDD:275381 4/11 (36%)
leucine-rich repeat 619..641 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.