Sequence 1: | NP_001303481.1 | Gene: | CG12402 / 41714 | FlyBaseID: | FBgn0038202 | Length: | 671 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005272105.1 | Gene: | FBXL17 / 64839 | HGNCID: | 13615 | Length: | 712 | Species: | Homo sapiens |
Alignment Length: | 318 | Identity: | 71/318 - (22%) |
---|---|---|---|
Similarity: | 137/318 - (43%) | Gaps: | 64/318 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 326 PESAPIRQLDLTGMLSLTNELLL--------YVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSG 382
Fly 383 RLEALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCR 447
Fly 448 QAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVTDSS 512
Fly 513 LMVGLK-LPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMA------------------ 558
Fly 559 ------VDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNL--VQLIACSI 608 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12402 | NP_001303481.1 | F-box | 75..117 | CDD:279040 | |
leucine-rich repeat | 281..303 | CDD:275381 | |||
LRR_RI | <297..482 | CDD:238064 | 36/163 (22%) | ||
leucine-rich repeat | 304..330 | CDD:275381 | 2/3 (67%) | ||
leucine-rich repeat | 331..357 | CDD:275381 | 8/33 (24%) | ||
leucine-rich repeat | 358..379 | CDD:275381 | 5/20 (25%) | ||
leucine-rich repeat | 384..409 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 412..437 | CDD:275381 | 3/24 (13%) | ||
AMN1 | 430..595 | CDD:187754 | 41/189 (22%) | ||
leucine-rich repeat | 438..464 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 465..496 | CDD:275381 | 8/30 (27%) | ||
leucine-rich repeat | 497..521 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 522..547 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 548..573 | CDD:275381 | 8/48 (17%) | ||
leucine-rich repeat | 574..599 | CDD:275381 | 6/24 (25%) | ||
FBXL17 | XP_005272105.1 | F-box-like | 321..368 | CDD:289689 | 13/57 (23%) |
leucine-rich repeat | 362..387 | CDD:275381 | 9/44 (20%) | ||
leucine-rich repeat | 388..413 | CDD:275381 | 3/24 (13%) | ||
AMN1 | 411..573 | CDD:187754 | 37/168 (22%) | ||
leucine-rich repeat | 414..439 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 440..465 | CDD:275381 | 8/30 (27%) | ||
leucine-rich repeat | 466..491 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 492..517 | CDD:275381 | 4/24 (17%) | ||
leucine-rich repeat | 518..541 | CDD:275381 | 2/22 (9%) | ||
leucine-rich repeat | 542..567 | CDD:275381 | 6/24 (25%) | ||
AMN1 | 547..>652 | CDD:187754 | 18/58 (31%) | ||
leucine-rich repeat | 568..593 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 594..615 | CDD:275381 | 4/11 (36%) | ||
leucine-rich repeat | 619..641 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |