DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and Fbxo39

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:XP_006533964.2 Gene:Fbxo39 / 628100 MGIID:3505735 Length:480 Species:Mus musculus


Alignment Length:466 Identity:99/466 - (21%)
Similarity:166/466 - (35%) Gaps:120/466 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 DKDKEGSSKAAIELLPNEMWLEIMSYLSYN-DLLQLRMVSWRCR-DLVHRRRFMEKGKVIVTQHN 126
            |:|:   |:||   |....|.:||    |: ||.:.|.:::..| ..||...| |.....:.:..
Mouse    70 DRDR---SRAA---LVCRKWNQIM----YSADLWRYRTITFSGRPSRVHASEF-ESALWYIKKFG 123

  Fly   127 LEAIHKHAKGGNCY-----LSFERIELRNLRQCRQLENFLRLVGHEVKHLQVRHAPVFRN-LDGK 185
            ....|...|..|.|     ..|: :.:|.|..|....| .||....::||::... |:|| :.|.
Mouse   124 RYLEHLEIKFLNPYNAVLTKKFQ-VTMRGLLSCLGKSN-NRLRSLSIQHLELDRL-VWRNSIRGS 185

  Fly   186 LPNLKVLTIATTMSMDDQHLAAMDDLDMK-------QFSHLVGFECDGVSLDAVLKMRMLLQLRR 243
            |    :.:::..:....:||   |.|.:|       |..|::.      ||..:....|..:|..
Mouse   186 L----IKSLSFFLKKMGKHL---DHLSLKGARLTVEQGCHILN------SLSYMQNENMASELNI 237

  Fly   244 TE--------------NKVQLRHLQFEFRRNNENALLDVL-----QDHAETLVCVNLFFSC---- 285
            .:              ||.........|...|.|.:.|.|     :::|.||..:|:  .|    
Mouse   238 EDFFSHHLAVYGSSQFNKAMATFRNLTFLTLNYNCISDELLETLSENNAGTLRTMNI--KCHVHD 300

  Fly   286 --SPGIDTREWCRAFENMHNL-------RTLKLSGNCHLVLLEAVLRAVPESAPIRQLDLT---- 337
              ...:....|.:......||       |.:|         .|.:.|.:.:..|:|.:.|.    
Mouse   301 PHGQVVWGMSWAKLARQASNLKVNFFFERVMK---------YERLARILLQEIPVRSISLRSCYF 356

  Fly   338 -----GMLSLTNELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTG 397
                 .|.....:||    ..:::||:.|...|    |.|    ...|..:|..|.:| ||:|..
Mouse   357 SDPDWSMRPTLTDLL----PTFRNTLQKLTFEF----NNN----HESLDEQLHLLILA-CRKLFY 408

  Fly   398 TGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLR-RLSLDNCRQAVTDRTMATICQY 461
            ..:...|  |:.:      :|..:...|...|.    |..|: |:..:.......|||:..|.:.
Mouse   409 FKIWAFL--DVKF------VERILKSQEEGQCS----LHTLKVRIYTNRYETNEEDRTLREIYRK 461

  Fly   462 QTRLRNLNIEY 472
            ..:|.:..:.|
Mouse   462 YRKLIDSELNY 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040 12/43 (28%)
leucine-rich repeat 281..303 CDD:275381 2/27 (7%)
LRR_RI <297..482 CDD:238064 39/193 (20%)
leucine-rich repeat 304..330 CDD:275381 5/32 (16%)
leucine-rich repeat 331..357 CDD:275381 5/34 (15%)
leucine-rich repeat 358..379 CDD:275381 5/20 (25%)
leucine-rich repeat 384..409 CDD:275381 8/24 (33%)
leucine-rich repeat 412..437 CDD:275381 4/24 (17%)
AMN1 430..595 CDD:187754 9/44 (20%)
leucine-rich repeat 438..464 CDD:275381 6/26 (23%)
leucine-rich repeat 465..496 CDD:275381 2/8 (25%)
leucine-rich repeat 497..521 CDD:275381
leucine-rich repeat 522..547 CDD:275381
leucine-rich repeat 548..573 CDD:275381
leucine-rich repeat 574..599 CDD:275381
Fbxo39XP_006533964.2 F-box-like 53..94 CDD:372399 12/33 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.