DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and fbxl3l

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:XP_693270.2 Gene:fbxl3l / 564855 ZFINID:ZDB-GENE-130530-598 Length:448 Species:Danio rerio


Alignment Length:531 Identity:98/531 - (18%)
Similarity:168/531 - (31%) Gaps:156/531 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 RNLRQCRQLENFLRLVGHEVKHLQVRHAPV--------FRNLD----GKLPNLKVLTIATTMSMD 201
            |...:|   ::|....|...:|...  .||        |:|..    |.||:..||.|...:|:.
Zfish    15 RGRSKC---QSFTPSEGRNKRHRST--TPVYVQTGSTNFQNATEETWGNLPHHVVLHIFQYLSLV 74

  Fly   202 DQHLAAMDDLDMKQFSHLVGFECDGVSLDAVLKMRMLLQLRRTENKVQLRHLQFE--------FR 258
            |:..|:.......:..|:...                           .|..:||        .|
Zfish    75 DRARASSVCRRWNEVFHIPDL---------------------------WRRFEFELNQPATSYLR 112

  Fly   259 RNNENALLDVLQDHAETLVCVNL-FFSCSPGIDTREWCRAFENMHNLRTLKLSGNCHLVLLEAVL 322
            ..:.:.:..:::.||:.|..|:. ..||:...:..  |.....:         .||.:..|..:.
Zfish   113 STHPDLIQQIIKRHAQHLQYVSFKVDSCTESAEAA--CNILSQL---------VNCTIKTLGLIS 166

  Fly   323 RAVPESAPIRQLDLTGMLSLTNELLLYVAGKWQSTLKVLD-------LMFCVQLNANCIDALRQL 380
            .|.|....:.|......|:     :::|..|..|::|:.|       |...|..|          
Zfish   167 TARPSFMDVSQSHFVSALT-----VVFVNSKSLSSIKIDDTPVDDPSLKVLVANN---------- 216

  Fly   381 SGRLEALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDN 445
            |..|:.|.|:.|..::..|:|  ...|..:.|:||.|...:..||..:....|:..:|..|.:|.
Zfish   217 SDTLKLLKMSSCPHVSPAGIL--CVADQCHGLRELALNYHLLSDELLLALSSEKHVHLEHLRIDV 279

  Fly   446 CRQAVTDRTMATI--CQYQTRLRN---LNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGC 505
            ..:........||  ..:...:|:   :||.....:.::....:.....|::.|           
Zfish   280 VSENPGQTQFHTIKKSSWDALIRHSPQVNIVMYFFLYEEEFEPFFREETPVTHL----------- 333

  Fly   506 RNVTDSSLMVGLKLPELRALSLGYCNRLTSEG-FEALTQNCPSLEAL--CVSSCMAVDDETVLNI 567
                                   |..|..|:. ...:..|||.|..|  |.:....:|:| ::.|
Zfish   334 -----------------------YFGRAVSKDMLGRIGLNCPRLVELVVCANGLEPLDEE-LIRI 374

  Fly   568 VSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNLVQLIACSIDGMDHEQAQRILESQRPQMKQVLL 632
            ....|.|..:.|..|.......:..:...|..|.||   ||                  |::||:
Zfish   375 ADRCKSLTAIGLGECEVTCSGFMEFVKMCGGRLSQL---SI------------------MEEVLI 418

  Fly   633 XQERY----IH 639
             ...|    ||
Zfish   419 PDNTYNIEQIH 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 3/22 (14%)
LRR_RI <297..482 CDD:238064 38/196 (19%)
leucine-rich repeat 304..330 CDD:275381 5/25 (20%)
leucine-rich repeat 331..357 CDD:275381 4/25 (16%)
leucine-rich repeat 358..379 CDD:275381 5/27 (19%)
leucine-rich repeat 384..409 CDD:275381 7/24 (29%)
leucine-rich repeat 412..437 CDD:275381 7/24 (29%)
AMN1 430..595 CDD:187754 27/172 (16%)
leucine-rich repeat 438..464 CDD:275381 5/27 (19%)
leucine-rich repeat 465..496 CDD:275381 5/33 (15%)
leucine-rich repeat 497..521 CDD:275381 0/23 (0%)
leucine-rich repeat 522..547 CDD:275381 5/25 (20%)
leucine-rich repeat 548..573 CDD:275381 6/26 (23%)
leucine-rich repeat 574..599 CDD:275381 4/24 (17%)
fbxl3lXP_693270.2 F-box-like 56..99 CDD:289689 11/69 (16%)
leucine-rich repeat 194..218 CDD:275381 6/33 (18%)
leucine-rich repeat 220..245 CDD:275381 7/26 (27%)
leucine-rich repeat 246..271 CDD:275381 7/24 (29%)
leucine-rich repeat 272..306 CDD:275381 6/33 (18%)
leucine-rich repeat 307..353 CDD:275381 9/79 (11%)
AMN1 <347..>412 CDD:187754 17/68 (25%)
leucine-rich repeat 354..380 CDD:275381 6/26 (23%)
leucine-rich repeat 381..403 CDD:275381 3/21 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.