DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and FBXL12

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:XP_016882401.1 Gene:FBXL12 / 54850 HGNCID:13611 Length:343 Species:Homo sapiens


Alignment Length:297 Identity:69/297 - (23%)
Similarity:104/297 - (35%) Gaps:100/297 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 RQLSGRLEALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLS 442
            |.::.||.:|.|       |..|..|              .:...|..:.:..|.::.|||:||.
Human    82 RYMASRLHSLRM-------GGYLFSG--------------SQAPQLSPALLRALGQKCPNLKRLC 125

  Fly   443 LDNCRQAVTDRTMATICQYQTRLRNLNIEYC---------------------------MKITDQG 480
            |.     |.|.:|..|....:.||.|.:..|                           ....|:.
Human   126 LH-----VADLSMVPITSLPSTLRTLELHSCEISMAWLHKQQDPTVLPLLECIVLDRVPAFRDEH 185

  Fly   481 LMGYGDTPYPISRLRGLKELNLRGCRNVTDSSLMVGL-KLPELRALSLGYCN------------- 531
            |.|       ::|.|.|:.|.|.|...||::.|..|| :|..|:.|.:..|.             
Human   186 LQG-------LTRFRALRSLVLGGTYRVTETGLDAGLQELSYLQRLEVLGCTLSADSTLLAISRH 243

  Fly   532 -------RLTSEGFE----ALTQNCPSLEALCVSSCMAVDD----ETVLNIVSNLKRLRVLNLSN 581
                   |||..|..    |:.:..|:||:||:...:...:    ..:|:....:.:||||.|..
Human   244 LRDVRKIRLTVRGLSAPGLAVLEGMPALESLCLQGPLVTPEMPSPTEILSSCLTMPKLRVLELQG 308

  Fly   582 CTKLTL----QSIHHILAHG--HNLVQLIACSIDGMD 612
                 |    |....||..|  |.:|.:.||..:.||
Human   309 -----LGWEGQEAEKILCKGLPHCMVIVRACPKESMD 340

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381
LRR_RI <297..482 CDD:238064 25/130 (19%)
leucine-rich repeat 304..330 CDD:275381
leucine-rich repeat 331..357 CDD:275381