DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and Fbxl3

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001347270.1 Gene:Fbxl3 / 50789 MGIID:1354702 Length:428 Species:Mus musculus


Alignment Length:461 Identity:94/461 - (20%)
Similarity:157/461 - (34%) Gaps:130/461 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 CDGVSL--DAVLKMRMLLQL--RRTENKV-----QLRHLQ-----FEFRRN----------NENA 264
            ||..:|  |.||.:...|.|  |...::|     |:.|:.     |||..|          :...
Mouse    34 CDWGNLLQDIVLHVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPEL 98

  Fly   265 LLDVLQDHAETLVCVNLFFSCSPGIDTREWCRAFENMHNLRTLKLSGNCHLVLLEAVLRAVPESA 329
            :..:::.|:..|..|:  |......::.|  .|.:.:..|      .||.|..|..:..|.|.. 
Mouse    99 IKQIIKRHSNHLQYVS--FKVDSSKESAE--AACDILSQL------VNCSLKTLGLISTARPSF- 152

  Fly   330 PIRQLDLTGMLSLTNELLLYVAGKWQSTLKVLD-------LMFCVQLNANCIDALRQLSGRLEAL 387
                :||.....::...:::|..|..|:||:.|       |...|..|          |..|:.|
Mouse   153 ----MDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLVANN----------SDTLKLL 203

  Fly   388 TMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQAVTD 452
            .|:.|..::..|:|  ...|..:.|:||.|...:..||     ||..|.:.:.:.|::.|..|..
Mouse   204 KMSSCPHVSPAGIL--CVADQCHGLRELALNYHLLSDE-----LLLALSSEKHVRLEHLRIDVVS 261

  Fly   453 RTMATICQYQTRLRNLN-------IEYCMKIT-DQGLMGYGDTPYPISRLRGLKELNLRGCRNVT 509
            ....     ||....:.       |::..|:. ......|.:...|..|.               
Mouse   262 ENPG-----QTHFHTIQKSSWDAFIKHSPKVNLVMYFFLYEEEFDPFFRY--------------- 306

  Fly   510 DSSLMVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEAL--CVSSCMAVDDETVLNIVSNLK 572
                       |:.|..|.:...::.:....:...||.|..|  |.:....:|:| ::.|....|
Mouse   307 -----------EIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEE-LIRIAERCK 359

  Fly   573 RLRVLNLSNCTKLTLQSIHHILAHGHNLVQLIACSIDGMDHEQAQRILESQRPQMKQVLLXQERY 637
            .|..:.|..|.......:..:...|..|.||   ||                  |::||:..::|
Mouse   360 NLSAIGLGECEVSCSAFVEFVKMCGGRLSQL---SI------------------MEEVLIPDQKY 403

  Fly   638 ----IH 639
                ||
Mouse   404 SLEQIH 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 3/21 (14%)
LRR_RI <297..482 CDD:238064 43/199 (22%)
leucine-rich repeat 304..330 CDD:275381 7/25 (28%)
leucine-rich repeat 331..357 CDD:275381 4/25 (16%)
leucine-rich repeat 358..379 CDD:275381 6/27 (22%)
leucine-rich repeat 384..409 CDD:275381 7/24 (29%)
leucine-rich repeat 412..437 CDD:275381 9/24 (38%)
AMN1 430..595 CDD:187754 28/174 (16%)
leucine-rich repeat 438..464 CDD:275381 4/25 (16%)
leucine-rich repeat 465..496 CDD:275381 5/38 (13%)
leucine-rich repeat 497..521 CDD:275381 0/23 (0%)
leucine-rich repeat 522..547 CDD:275381 3/24 (13%)
leucine-rich repeat 548..573 CDD:275381 6/26 (23%)
leucine-rich repeat 574..599 CDD:275381 4/24 (17%)
Fbxl3NP_001347270.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
F-box-like 36..77 CDD:315592 10/40 (25%)
LRR 1 119..146 7/34 (21%)
leucine-rich repeat 174..199 CDD:275381 8/34 (24%)
LRR 2 181..207 8/35 (23%)
leucine-rich repeat 200..225 CDD:275381 7/26 (27%)
LRR 3 208..233 8/26 (31%)
LRR 4 234..259 7/29 (24%)
leucine-rich repeat 252..286 CDD:275381 6/38 (16%)
leucine-rich repeat 287..333 CDD:275381 7/71 (10%)
LRR 5 316..341 4/24 (17%)
leucine-rich repeat 334..360 CDD:275381 6/26 (23%)
LRR 6 343..368 6/25 (24%)
leucine-rich repeat 361..383 CDD:275381 3/21 (14%)
LRR 7 369..394 7/45 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.