DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and FipoQ

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_733291.1 Gene:FipoQ / 43475 FlyBaseID:FBgn0039667 Length:515 Species:Drosophila melanogaster


Alignment Length:586 Identity:130/586 - (22%)
Similarity:226/586 - (38%) Gaps:165/586 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 IELLPNEMWLEIMSYLSYNDLLQLRMVSWRCRDLVHRRRFMEKGKVIVTQHNLEAIHKHAKGGNC 139
            ||.||:::.|.|.||||:.::.:|..:..|.|.:.:..|..   |.:..:..:..:|.    |:.
  Fly    34 IEKLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLW---KNVSLRPEVSGLHV----GSL 91

  Fly   140 YLSFERIELRNLRQCRQLENFLRLVGHEVKHLQVRHAPVFRNLDGKLPNL--KVLTIATTMSMDD 202
            .:..:.|.:|.....|.:|..:.|:.|.|.|          .|..|.|||  .:|..:|.|.:.|
  Fly    92 EMLLQLISVRFGPTLRYIELPIELITHTVLH----------ELSAKCPNLTHMLLDFSTAMQLHD 146

  Fly   203 QHLAAMDDLDMKQFSHLVGFECDGVSLDAVLKMR-MLLQLRRTENKVQLRHL--QFEFRRNNENA 264
            ..       :|:.|...:.:.|  |.|..|:.|. .:.::....|.:::.||  .:|.....|..
  Fly   147 FS-------EMQAFPTKLRYMC--VCLSEVIFMEGFMRKIYNFINGLEVLHLIGTYEKCEEEEEE 202

  Fly   265 LLDVLQDHAETLVCVNLFFSCSPGIDTREWCRAFENMHNLRTLKLSGNCHLVLLEAVLRAVPESA 329
            :.:|:..|.        ..|.:|               |||.:.|.|                  
  Fly   203 IYEVINVHK--------LKSATP---------------NLRVINLYG------------------ 226

  Fly   330 PIRQLDLTGMLSLTNELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRE 394
             |..:|.:.:.:.::..:         .|:.|.:.||.::..:.:..|.|.|.||..|.|     
  Fly   227 -INFIDDSHIDAFSSNCI---------QLECLAVNFCNKVTGSTLKTLIQRSKRLTCLLM----- 276

  Fly   395 LTGTGLLQGLAGDINY---SLQELHLEETIFLDESSMC--QLLERLPNLRRLS---LDNCRQAVT 451
             .||.|.........:   :||||.:..|   |.|:.|  .:|.|:|:|:.||   ::....:|.
  Fly   277 -NGTSLKSEFVMQAEWDKCALQELDITAT---DLSTECLVDMLSRIPSLKFLSAGQINGFNDSVL 337

  Fly   452 DRTMATICQYQTR-LRNLNIEYCMKITDQGLMGYGDTPYPISRLRG--LKELNLRGCRNVTDSSL 513
            .:.|.:   ..|| |.:|:::....|:|:||:.:      |.| :|  |....|.|..::||...
  Fly   338 KQWMES---GTTRSLISLDLDSSDNISDEGLLKF------IQR-QGHQLSACCLSGMPHITDQLW 392

  Fly   514 MVGLKLPELRALSLGYCNRL---TSEG----------FEALTQNCPSLEAL-------------- 551
            |..|.|       ||.|..:   |:|.          .:.:..||.:||.|              
  Fly   393 MSILPL-------LGNCKIIVMGTAEKLGVNIHVDQLMDTIASNCGNLERLELRWDPDNLRFSDK 450

  Fly   552 -----------CVS-SCMAVDD----ETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNL 600
                       |:. .||.:.|    |||........|:.|:..:.|.::   |.:|:|.:.::|
  Fly   451 SQKAIDILRVKCLKLRCMVLSDGRYYETVKANFERADRITVVRTTTCCRV---SPYHLLRNYNDL 512

  Fly   601 V 601
            :
  Fly   513 I 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040 14/41 (34%)
leucine-rich repeat 281..303 CDD:275381 2/21 (10%)
LRR_RI <297..482 CDD:238064 44/193 (23%)
leucine-rich repeat 304..330 CDD:275381 4/25 (16%)
leucine-rich repeat 331..357 CDD:275381 2/25 (8%)
leucine-rich repeat 358..379 CDD:275381 5/20 (25%)
leucine-rich repeat 384..409 CDD:275381 6/24 (25%)
leucine-rich repeat 412..437 CDD:275381 10/26 (38%)
AMN1 430..595 CDD:187754 49/213 (23%)
leucine-rich repeat 438..464 CDD:275381 5/28 (18%)
leucine-rich repeat 465..496 CDD:275381 8/30 (27%)
leucine-rich repeat 497..521 CDD:275381 8/23 (35%)
leucine-rich repeat 522..547 CDD:275381 7/37 (19%)
leucine-rich repeat 548..573 CDD:275381 10/54 (19%)
leucine-rich repeat 574..599 CDD:275381 5/24 (21%)
FipoQNP_733291.1 F-box-like 34..80 CDD:289689 15/48 (31%)
leucine-rich repeat 131..156 CDD:275381 7/31 (23%)
leucine-rich repeat 157..175 CDD:275381 5/19 (26%)
leucine-rich repeat 219..244 CDD:275381 6/52 (12%)
leucine-rich repeat 245..270 CDD:275381 7/24 (29%)
leucine-rich repeat 271..295 CDD:275381 6/29 (21%)
leucine-rich repeat 296..320 CDD:275381 10/26 (38%)
leucine-rich repeat 321..348 CDD:275381 6/29 (21%)
leucine-rich repeat 349..375 CDD:275381 9/32 (28%)
leucine-rich repeat 376..403 CDD:275381 10/33 (30%)
leucine-rich repeat 405..432 CDD:275381 4/26 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457989
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.