DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and CG14891

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_650560.1 Gene:CG14891 / 42013 FlyBaseID:FBgn0038445 Length:495 Species:Drosophila melanogaster


Alignment Length:541 Identity:116/541 - (21%)
Similarity:196/541 - (36%) Gaps:174/541 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 PTPEKLDSDKDKEGSSKAAIEL-LPNEMWLEIMSYLSYNDLLQLRMVSWRCRDLVHRRRFMEKGK 119
            |||.       :|..:.:|.:| :.:::|.:::.|||.|:.|..   :..|      .||     
  Fly   100 PTPV-------EESGTLSAYDLPITDDIWWKVLDYLSLNERLNF---AASC------ERF----- 143

  Fly   120 VIVTQHNLEAIHKHAKGGNCYLSFERI-ELRNLRQ-C----RQLENFLRLVGHEVKHLQ-VRHAP 177
                    :||::        |...|| .:.|::. |    |.::..:.|.|   ||:. |...|
  Fly   144 --------QAIYE--------LDSHRINHVLNMKDVCTLTHRVIKRLMLLSG---KHIHCVTGGP 189

  Fly   178 VFRNLDGKLPNLKVLTIATTMSMDDQHLAAMDDLDMKQFSHLVGFECDGVSLDAVLKMRMLLQLR 242
            :.       ||...||                     :|..|:|..|..           |.:|.
  Fly   190 LH-------PNWPYLT---------------------EFVQLLGVSCPN-----------LTELS 215

  Fly   243 RTENKVQLRHLQFEFRRNNENALLDVLQDHAETLVCVNLFFSCSPGIDTREWCRAFENMHNLRTL 307
            ..:..|.|.|:...|  :..|.|:::          .|:                     :||..
  Fly   216 FFKISVSLAHMTHLF--DGANGLINI----------TNI---------------------SLRRC 247

  Fly   308 KLSGNCHLVLLEAVLRAVPESAPIRQLDLTGMLSLTNELLLYVAGKWQSTLKVLDLMFCVQLNAN 372
            .|. :.|:..|:.:       :.::.||:....|:..:.|..:    ..:|::|::..||.|:..
  Fly   248 NLK-DAHIYCLQML-------SKLKSLDIRENFSIKGDSLKSL----PISLEILNVSGCVDLSPK 300

  Fly   373 CIDALRQLSGRLEALTMAYCRELTGTGLLQGLAGDINYSLQELH---------LEETIFLDESSM 428
            |:..|..||         :.|||...|::: .|.|     .||:         ||.....|..::
  Fly   301 CLIQLAALS---------HLRELRCPGIVK-FAKD-----NELYGRLAHYCPMLEVLELTDFMNV 350

  Fly   429 CQL--LERLPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYG---DTP 488
            .||  |.||..|...|.......|.:..:.:|.:..: ||:|.|          |..:|   ||.
  Fly   351 IQLGGLSRLHTLVIHSSAQLDYHVNNVLLTSIAESYS-LRHLEI----------LDSFGPMSDTS 404

  Fly   489 YPISRLRGLKELNLRGCRNVTDSSL-MVGL-KLPELRALSLGYCNRLTSEGFEALTQNCPSLEAL 551
            :.:|....||||......|...::| ::|| ||..|..|.|.....|::|....||::...|..|
  Fly   405 FDLSIFSQLKELRTLILHNQNFTTLHLMGLQKLSTLEFLDLSGSPNLSNEVVAKLTKSLSGLRRL 469

  Fly   552 CVSSCMAVDDETVLNIVSNLK 572
            .|..|..:..:....:..|.|
  Fly   470 KVDFCPLITRQLTKILEGNPK 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040 10/42 (24%)
leucine-rich repeat 281..303 CDD:275381 0/21 (0%)
LRR_RI <297..482 CDD:238064 42/195 (22%)
leucine-rich repeat 304..330 CDD:275381 5/25 (20%)
leucine-rich repeat 331..357 CDD:275381 4/25 (16%)
leucine-rich repeat 358..379 CDD:275381 7/20 (35%)
leucine-rich repeat 384..409 CDD:275381 6/24 (25%)
leucine-rich repeat 412..437 CDD:275381 10/35 (29%)
AMN1 430..595 CDD:187754 41/150 (27%)
leucine-rich repeat 438..464 CDD:275381 4/25 (16%)
leucine-rich repeat 465..496 CDD:275381 9/33 (27%)
leucine-rich repeat 497..521 CDD:275381 10/25 (40%)
leucine-rich repeat 522..547 CDD:275381 7/24 (29%)
leucine-rich repeat 548..573 CDD:275381 6/25 (24%)
leucine-rich repeat 574..599 CDD:275381
CG14891NP_650560.1 RRM_6 25..91 CDD:290958
AMN1 <199..352 CDD:187754 42/223 (19%)
leucine-rich repeat 211..237 CDD:275381 7/27 (26%)
leucine-rich repeat 239..262 CDD:275381 6/61 (10%)
leucine-rich repeat 263..285 CDD:275381 4/25 (16%)
leucine-rich repeat 286..338 CDD:275381 17/66 (26%)
leucine-rich repeat 339..387 CDD:275381 12/47 (26%)
leucine-rich repeat 388..415 CDD:275381 10/36 (28%)
leucine-rich repeat 416..439 CDD:275381 7/22 (32%)
leucine-rich repeat 440..465 CDD:275381 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458000
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.