Sequence 1: | NP_001303481.1 | Gene: | CG12402 / 41714 | FlyBaseID: | FBgn0038202 | Length: | 671 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998107.1 | Gene: | fbxl15 / 405878 | ZFINID: | ZDB-GENE-040426-2440 | Length: | 296 | Species: | Danio rerio |
Alignment Length: | 272 | Identity: | 60/272 - (22%) |
---|---|---|---|
Similarity: | 107/272 - (39%) | Gaps: | 68/272 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 354 WQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAY---CREL----TGTGLLQGLAGDINYS 411
Fly 412 LQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQAVTD------------------------ 452
Fly 453 --RTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVTDSSL-- 513
Fly 514 MVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNIVSNLKRLRVLN 578
Fly 579 LSNCTKLTLQSI 590 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12402 | NP_001303481.1 | F-box | 75..117 | CDD:279040 | |
leucine-rich repeat | 281..303 | CDD:275381 | |||
LRR_RI | <297..482 | CDD:238064 | 29/160 (18%) | ||
leucine-rich repeat | 304..330 | CDD:275381 | |||
leucine-rich repeat | 331..357 | CDD:275381 | 1/2 (50%) | ||
leucine-rich repeat | 358..379 | CDD:275381 | 5/20 (25%) | ||
leucine-rich repeat | 384..409 | CDD:275381 | 6/31 (19%) | ||
leucine-rich repeat | 412..437 | CDD:275381 | 4/24 (17%) | ||
AMN1 | 430..595 | CDD:187754 | 44/189 (23%) | ||
leucine-rich repeat | 438..464 | CDD:275381 | 8/51 (16%) | ||
leucine-rich repeat | 465..496 | CDD:275381 | 6/30 (20%) | ||
leucine-rich repeat | 497..521 | CDD:275381 | 8/25 (32%) | ||
leucine-rich repeat | 522..547 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 548..573 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 574..599 | CDD:275381 | 5/17 (29%) | ||
fbxl15 | NP_998107.1 | F-box | 16..>52 | CDD:279040 | 7/33 (21%) |
leucine-rich repeat | 51..85 | CDD:275381 | 10/56 (18%) | ||
leucine-rich repeat | 86..112 | CDD:275381 | 7/25 (28%) | ||
AMN1 | <111..272 | CDD:187754 | 36/156 (23%) | ||
leucine-rich repeat | 113..138 | CDD:275381 | 1/24 (4%) | ||
LRR 1 | 138..159 | 5/20 (25%) | |||
leucine-rich repeat | 139..164 | CDD:275381 | 5/25 (20%) | ||
LRR 2 | 164..185 | 6/25 (24%) | |||
leucine-rich repeat | 165..190 | CDD:275381 | 8/25 (32%) | ||
LRR 3 | 190..211 | 8/20 (40%) | |||
leucine-rich repeat | 191..216 | CDD:275381 | 8/24 (33%) | ||
LRR 4 | 216..237 | 5/20 (25%) | |||
leucine-rich repeat | 217..242 | CDD:275381 | 5/24 (21%) | ||
LRR 5 | 242..263 | 5/18 (28%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR13318 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |