DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and Skp2

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_730815.2 Gene:Skp2 / 40548 FlyBaseID:FBgn0037236 Length:559 Species:Drosophila melanogaster


Alignment Length:434 Identity:98/434 - (22%)
Similarity:146/434 - (33%) Gaps:156/434 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 FRRNNENALLDVLQ-DHAETL-----VCVNLFFSCSPGIDTREWCRAFENMHNLRTLKLSGNCHL 315
            |.|.::..|||:.: ...:||     || ..|..||.  |...|.|....:..:|...|.     
  Fly   239 FERLSDEILLDIFKWLPKKTLLRMATVC-RRFNRCSR--DETLWTRLDLGLRTIRPGALE----- 295

  Fly   316 VLLEAVLRAV------------PESAP--------IRQLDLTGMLSLTNELLLYVAGKWQSTLKV 360
               :.|.|.|            |..||        ::.|||: |.|:|...||        ||  
  Fly   296 ---QIVRRGVLVIRLAQTSIQEPAFAPYTEVFRTRLQYLDLS-MASITRSSLL--------TL-- 346

  Fly   361 LDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDE 425
                                        :::||:|.            ..||:.:.|::.|    
  Fly   347 ----------------------------LSHCRQLK------------KISLENIELDDDI---- 367

  Fly   426 SSMCQLLERLPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYP 490
               |..:.:...|..::| .....:|..::..:.:..|.|.:|||.:    ||  |.....|...
  Fly   368 ---CAEIAKNEALEAVNL-TMASGLTSNSVRLMMESLTSLSSLNISW----TD--LSADAVTALV 422

  Fly   491 ISRLRGLKELNLRGCRNVTDSSLMVGL--KLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCV 553
            ......|..||:.|||.|...|.:..|  :.|:|..|.|..||.||                   
  Fly   423 THISPNLIRLNIAGCRRVLFDSHVATLQKRCPQLLELDLSDCNSLT------------------- 468

  Fly   554 SSCMAVDDETVLNIVSNLKRLRVLNLSNC-----TK-LTLQSIHHILAHGHNLVQLIACSIDGMD 612
                    .||:..:...|.|..|::|.|     || :.|:|          :..|....|.||.
  Fly   469 --------PTVITAIMKFKMLEYLSVSRCYLIPATKFIELKS----------MPSLTYLDIFGML 515

  Fly   613 HEQAQRILESQRPQMKQVLLXQERYIHXR-SR---NTPHHNDWG 652
            .:.|..:||.|.|:|     ...::||.. ||   .|...:.||
  Fly   516 SDTAMEVLEKQLPKM-----GINKFIHSSVSRPTVGTRRTSIWG 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 6/21 (29%)
LRR_RI <297..482 CDD:238064 36/204 (18%)
leucine-rich repeat 304..330 CDD:275381 6/37 (16%)
leucine-rich repeat 331..357 CDD:275381 8/25 (32%)
leucine-rich repeat 358..379 CDD:275381 1/20 (5%)
leucine-rich repeat 384..409 CDD:275381 3/24 (13%)
leucine-rich repeat 412..437 CDD:275381 4/24 (17%)
AMN1 430..595 CDD:187754 40/172 (23%)
leucine-rich repeat 438..464 CDD:275381 3/25 (12%)
leucine-rich repeat 465..496 CDD:275381 8/30 (27%)
leucine-rich repeat 497..521 CDD:275381 9/25 (36%)
leucine-rich repeat 522..547 CDD:275381 7/24 (29%)
leucine-rich repeat 548..573 CDD:275381 2/24 (8%)
leucine-rich repeat 574..599 CDD:275381 8/30 (27%)
Skp2NP_730815.2 F-box-like 239..284 CDD:289689 15/47 (32%)
leucine-rich repeat 302..327 CDD:275381 4/24 (17%)
AMN1 309..480 CDD:187754 52/262 (20%)
leucine-rich repeat 328..352 CDD:275381 11/62 (18%)
leucine-rich repeat 353..376 CDD:275381 6/41 (15%)
leucine-rich repeat 377..402 CDD:275381 3/25 (12%)
leucine-rich repeat 403..428 CDD:275381 8/30 (27%)
leucine-rich repeat 429..455 CDD:275381 9/25 (36%)
leucine-rich repeat 456..480 CDD:275381 9/50 (18%)
leucine-rich repeat 481..500 CDD:275381 6/18 (33%)
leucine-rich repeat 506..529 CDD:275381 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458002
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.