DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and fbxl2

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_956400.1 Gene:fbxl2 / 378737 ZFINID:ZDB-GENE-030925-12 Length:432 Species:Danio rerio


Alignment Length:322 Identity:85/322 - (26%)
Similarity:147/322 - (45%) Gaps:55/322 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   296 RAFENMHN-----LRTLKLSGNCHLVLLEAVLRAVPESA-PIRQLDLTGMLSLTNELLLYVAGKW 354
            |..||:..     ||.|.|.| | |.:.:|.::...::. .|..|:|.|...:|:...:.:: |:
Zfish    76 RVVENISKRCGGFLRQLSLRG-C-LSVGDASMKTFAQNCRNIEHLNLNGCTKITDSTCISLS-KF 137

  Fly   355 QSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTGLLQGLAGDINYSLQELHLEE 419
            ...|:.|||..||.:..:.:.||.:....||.|.:::|.::|..|:                   
Zfish   138 CFKLRHLDLTSCVSITNHALKALSEGCRMLENLNLSWCDQITSDGI------------------- 183

  Fly   420 TIFLDESSMCQLLER-LPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMG 483
                      :.|.| ...||.|.|..|.| :.|..:..:.::...|..:|::.|.:|||.|.  
Zfish   184 ----------EALSRGCTALRALFLRGCTQ-LDDTALKHLQKHCPELMTINMQSCTQITDDGF-- 235

  Fly   484 YGDTPYPISRLRGLKELN---LRGCRNVTDSSL-MVGLKLPELRALSLGYCNRLTSEGFEALTQN 544
                   :|..||..:|.   :.||.|:||:|| .:||....|:.|....|:.:|..||..|.:|
Zfish   236 -------VSLCRGCHKLQMVCISGCSNITDASLTALGLNCQRLKILEAARCSHVTDAGFTVLARN 293

  Fly   545 CPSLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAH--GHNLVQLI 604
            |..:|.:.:..|:.|.|.|::.:..:..||:.|:||:|..:|...|.|:.:.  |...:|::
Zfish   294 CHEMEKMDLEECILVTDNTLVQLSIHCPRLQALSLSHCELITDDGIRHLSSSVCGQERLQVV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 3/6 (50%)
LRR_RI <297..482 CDD:238064 46/191 (24%)
leucine-rich repeat 304..330 CDD:275381 8/26 (31%)
leucine-rich repeat 331..357 CDD:275381 6/25 (24%)
leucine-rich repeat 358..379 CDD:275381 8/20 (40%)
leucine-rich repeat 384..409 CDD:275381 6/24 (25%)
leucine-rich repeat 412..437 CDD:275381 2/25 (8%)
AMN1 430..595 CDD:187754 52/169 (31%)
leucine-rich repeat 438..464 CDD:275381 7/25 (28%)
leucine-rich repeat 465..496 CDD:275381 8/30 (27%)
leucine-rich repeat 497..521 CDD:275381 10/27 (37%)
leucine-rich repeat 522..547 CDD:275381 9/24 (38%)
leucine-rich repeat 548..573 CDD:275381 5/24 (21%)
leucine-rich repeat 574..599 CDD:275381 9/26 (35%)
fbxl2NP_956400.1 F-box-like 24..66 CDD:289689
leucine-rich repeat 61..88 CDD:275381 3/11 (27%)
AMN1 63..284 CDD:187754 63/249 (25%)
leucine-rich repeat 89..108 CDD:275381 8/20 (40%)
leucine-rich repeat 115..140 CDD:275381 6/25 (24%)
leucine-rich repeat 141..166 CDD:275381 8/24 (33%)
leucine-rich repeat 167..192 CDD:275381 8/53 (15%)
leucine-rich repeat 193..218 CDD:275381 7/25 (28%)
AMN1 212..390 CDD:187754 45/153 (29%)
leucine-rich repeat 219..244 CDD:275381 10/33 (30%)
leucine-rich repeat 245..270 CDD:275381 10/24 (42%)
leucine-rich repeat 271..296 CDD:275381 9/24 (38%)
leucine-rich repeat 297..322 CDD:275381 5/24 (21%)
leucine-rich repeat 323..351 CDD:275381 9/27 (33%)
leucine-rich repeat 352..376 CDD:275381 1/4 (25%)
leucine-rich repeat 377..402 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13318
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.