DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and Ppa

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001261138.1 Gene:Ppa / 37602 FlyBaseID:FBgn0020257 Length:562 Species:Drosophila melanogaster


Alignment Length:349 Identity:86/349 - (24%)
Similarity:153/349 - (43%) Gaps:48/349 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 WCRAFENMHNLRTLKLSGNC---------HLVLLEAVLRAVPESAP-IRQLDLTGMLSLTNELLL 348
            |......:|..|:.....||         .::.|...|:.:....| :..|:|:|..::.:..|.
  Fly   189 WKGVEAKLHLKRSSPSLFNCLVKRGIKKVQILSLRRSLKDLVLGVPALTSLNLSGCFNVADMNLG 253

  Fly   349 YVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTGLL---QGLAGDINY 410
            :........||.|||..|.|:....:..:.|....||.|.:..|..:|.||||   .||.     
  Fly   254 HAFSVDLPNLKTLDLSLCKQITDTSLGRIAQHLRNLETLELGGCCNITNTGLLLIAWGLK----- 313

  Fly   411 SLQELHLEETIFLDESSMCQL-------LERLPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNL 468
            .|:.|:|.....:.:..:..|       .|....|..|.|.:| |.::|..:..|.|..|.|:::
  Fly   314 KLKHLNLRSCWHISDQGIGHLAGFSRETAEGNLQLEYLGLQDC-QRLSDEALGHIAQGLTSLKSI 377

  Fly   469 NIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVTDSSLMVGLK-LPE----LRALSLG 528
            |:.:|:.:||.||.       .::|:..|::||||.|.|::|    :|:. |.|    :.:|.:.
  Fly   378 NLSFCVSVTDSGLK-------HLARMPKLEQLNLRSCDNISD----IGMAYLTEGGSGINSLDVS 431

  Fly   529 YCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHI 593
            :|::::.:....:.|....|.:|.::.|. :.|..:|.|...|..|..||:..|:::|.:.:..:
  Fly   432 FCDKISDQALTHIAQGLYRLRSLSLNQCQ-ITDHGMLKIAKALHELENLNIGQCSRITDKGLQTL 495

  Fly   594 LAHGHNL--VQLIAC---SIDGMD 612
            .....||  :.|..|   |..|:|
  Fly   496 AEDLTNLKTIDLYGCTQLSSKGID 519

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 1/8 (13%)
LRR_RI <297..482 CDD:238064 50/204 (25%)
leucine-rich repeat 304..330 CDD:275381 5/34 (15%)
leucine-rich repeat 331..357 CDD:275381 4/25 (16%)
leucine-rich repeat 358..379 CDD:275381 7/20 (35%)
leucine-rich repeat 384..409 CDD:275381 11/27 (41%)
leucine-rich repeat 412..437 CDD:275381 5/31 (16%)
AMN1 430..595 CDD:187754 45/176 (26%)
leucine-rich repeat 438..464 CDD:275381 8/25 (32%)
leucine-rich repeat 465..496 CDD:275381 8/30 (27%)
leucine-rich repeat 497..521 CDD:275381 10/24 (42%)
leucine-rich repeat 522..547 CDD:275381 3/24 (13%)
leucine-rich repeat 548..573 CDD:275381 7/24 (29%)
leucine-rich repeat 574..599 CDD:275381 5/24 (21%)