DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and CG11044

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_611456.1 Gene:CG11044 / 37281 FlyBaseID:FBgn0034484 Length:511 Species:Drosophila melanogaster


Alignment Length:378 Identity:83/378 - (21%)
Similarity:139/378 - (36%) Gaps:111/378 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   271 DHAETLVCVNLFFSCSPGIDTREWCRAFENMHNLRTL---------KLSGNCHLVLLEAVLRAVP 326
            ||..|..|::.......||:.|.| .:|.|:....|:         :::.:...:.:.:.:|.:.
  Fly   117 DHMRTQFCLSRIGRYVRGIEFRPW-HSFNNIFQFMTMLTWNIDKGREVNPDTQFIGIGSRIRTLV 180

  Fly   327 ESAPIR----------QLDLTG--MLSLTNELLLYVAGKWQSTLKVLDLMFCVQLNAN------- 372
            ...|..          :|..||  :|.:..||||.:..  ..|||::|.:. .:..||       
  Fly   181 YHFPCNMSQPNDPEGIKLFGTGGQLLRVLKELLLRLTD--LHTLKLVDFVL-ERYEANHLLDEVV 242

  Fly   373 --CIDALRQLSGRLEALTMAYCRELTGTGLL----------QGLAGDI-----NYSLQELHLEET 420
              |...:|.|:  |..:|..:| .:...||.          |.:..|:     :..|:.|||.:.
  Fly   243 CSCCTKMRVLN--LVNVTTMHC-PIMHVGLFLNLQVLTISPQNIDDDVLSLLADTKLRHLHLLQN 304

  Fly   421 IFLDES---SMC------QLLERLPNLR-RLSLDNCRQAVTDRTMA----------TICQYQTRL 465
            .:....   |.|      .:.:..|.|| .|.|:|    :||..:.          |.|..|||:
  Fly   305 CYTPSHLTISACGVKAWRNVKKTNPRLRVHLRLEN----LTDGEVVLQPEAPVHSITYCAPQTRI 365

  Fly   466 RNLNIEYCMKITD---QGLMGYG-------DTPYPI-SRLRGLKELNLRGCRNV----------T 509
            |   .|..:::.|   ..|..||       .:|.|. ||:..|..|..|.|.||          |
  Fly   366 R---AELLVRMVDHYKSTLAVYGHELLPRFSSPKPFHSRIDSLMLLMCRQCFNVDTLIIREKVST 427

  Fly   510 DSSLMVGLKLPELRALSLG------YCN-----RLTSEGFEALTQNCPSLEAL 551
            .:.|::......|:.|.:.      .|:     ..::|.:..|.:|..|.||:
  Fly   428 STLLLIAKTAKNLQHLHVRRFAVILRCDWPRHPEWSNEFYAWLKRNSRSYEAV 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 6/21 (29%)
LRR_RI <297..482 CDD:238064 51/252 (20%)
leucine-rich repeat 304..330 CDD:275381 2/34 (6%)
leucine-rich repeat 331..357 CDD:275381 8/37 (22%)
leucine-rich repeat 358..379 CDD:275381 6/29 (21%)
leucine-rich repeat 384..409 CDD:275381 7/39 (18%)
leucine-rich repeat 412..437 CDD:275381 6/33 (18%)
AMN1 430..595 CDD:187754 40/165 (24%)
leucine-rich repeat 438..464 CDD:275381 10/36 (28%)
leucine-rich repeat 465..496 CDD:275381 10/41 (24%)
leucine-rich repeat 497..521 CDD:275381 8/33 (24%)
leucine-rich repeat 522..547 CDD:275381 6/35 (17%)
leucine-rich repeat 548..573 CDD:275381 2/4 (50%)
leucine-rich repeat 574..599 CDD:275381
CG11044NP_611456.1 F-box-like 51..94 CDD:289689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.