DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and Fbxl6

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001005563.1 Gene:Fbxl6 / 362941 RGDID:1359687 Length:535 Species:Rattus norvegicus


Alignment Length:363 Identity:80/363 - (22%)
Similarity:128/363 - (35%) Gaps:78/363 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   269 LQDHAETLVCVNLFFSCSPGIDTREWC--RAFENMHNLRTLKLSGNCHLVLLEAVLRAVPESAPI 331
            |:...:.|.|:             ||.  ..|..:..|..:......|.| ||.|.:..|....:
  Rat   167 LKGEKKLLACL-------------EWLIPNRFSQLQRLTLIHWKSQVHSV-LELVSKFCPRLTFL 217

  Fly   332 RQLDLTGMLSLTNELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELT 396
            :..|..|   :|.|.|:.:| |....|..|||...:..:...:..|.:...|:..|.:.|..:. 
  Rat   218 KLSDCHG---VTAETLVMLA-KACCQLHSLDLHHSMVESTAVVSFLEEAGSRMRRLWLTYSSQT- 277

  Fly   397 GTGLLQGLAGDINYSLQELHLEETIFLDESSM----------CQLLERL---------------- 435
             |.:|..|.|:....||.|.:...:..:.:.:          |..|:.|                
  Rat   278 -TAILGALLGNCCSQLQVLEVSAGMSCNNTPLQLPVEALQRGCPQLQVLRLLNLIWLPKPCGRGA 341

  Fly   436 ------PNLRRLSL--DNCRQAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPIS 492
                  |:|..|.|  ..| ..|::..:..:.....:||.|::..|.:||..||     ...|..
  Rat   342 PQGPGFPSLEELCLAGSTC-SFVSNEVLGRLLHCSPKLRLLDLRGCARITPTGL-----CHLPCQ 400

  Fly   493 RLRGLKELNLRGCRN----VTDSSLMVGLK----LPELRALSLGYCNRLTSEG---FEALTQNCP 546
            .|..| .|.|.|..:    ..|.|.::..|    |.||.....|:..:...:.   |...|:..|
  Rat   401 ELEQL-YLGLYGMSDGLALAKDGSPLLTQKWYHTLRELDFSGQGFSEKDLEQALAVFSGTTEGLP 464

  Fly   547 SLEALCVSSCMA--VDDETVLNIVSNLKRLRVLNLSNC 582
              .|||..:...  |...||.:::|:...|..|||.:|
  Rat   465 --PALCSLNLRGTRVTPSTVSSVISSCPGLLYLNLESC 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 3/23 (13%)
LRR_RI <297..482 CDD:238064 46/218 (21%)
leucine-rich repeat 304..330 CDD:275381 7/25 (28%)
leucine-rich repeat 331..357 CDD:275381 7/25 (28%)
leucine-rich repeat 358..379 CDD:275381 5/20 (25%)
leucine-rich repeat 384..409 CDD:275381 6/24 (25%)
leucine-rich repeat 412..437 CDD:275381 6/56 (11%)
AMN1 430..595 CDD:187754 44/190 (23%)
leucine-rich repeat 438..464 CDD:275381 5/27 (19%)
leucine-rich repeat 465..496 CDD:275381 10/30 (33%)
leucine-rich repeat 497..521 CDD:275381 8/31 (26%)
leucine-rich repeat 522..547 CDD:275381 4/27 (15%)
leucine-rich repeat 548..573 CDD:275381 7/26 (27%)
leucine-rich repeat 574..599 CDD:275381 5/9 (56%)
Fbxl6NP_001005563.1 F-box-like 105..155 CDD:289689
AMN1 171..390 CDD:187754 47/239 (20%)
leucine-rich repeat 188..213 CDD:275381 6/25 (24%)
leucine-rich repeat 214..239 CDD:275381 7/28 (25%)
leucine-rich repeat 240..291 CDD:275381 12/52 (23%)
leucine-rich repeat 292..321 CDD:275381 4/28 (14%)
leucine-rich repeat 322..349 CDD:275381 2/26 (8%)
AMN1 <349..500 CDD:187754 40/159 (25%)
leucine-rich repeat 350..377 CDD:275381 5/27 (19%)
leucine-rich repeat 378..401 CDD:275381 9/27 (33%)
leucine-rich repeat 434..466 CDD:275381 7/33 (21%)
leucine-rich repeat 467..491 CDD:275381 6/23 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.