DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and Fbl6

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_610665.2 Gene:Fbl6 / 36201 FlyBaseID:FBgn0033609 Length:720 Species:Drosophila melanogaster


Alignment Length:393 Identity:88/393 - (22%)
Similarity:152/393 - (38%) Gaps:108/393 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 IDTREWCRAFENMHNLRTLKLSG-NCHLVLLEAVLRAVPESAPIRQLDLTGMLSLTNELLLYVAG 352
            :|.|  |.|..:: |:...|:|. ||.|..|.:   ..|..|.|   .|:|....|::.|.|:..
  Fly   358 VDNR--CSACTDL-NVSNWKISDINCFLAKLSS---GCPNLAGI---TLSGWKGFTSDHLTYLVD 413

  Fly   353 KWQSTLKVLDL-MFCVQLNAN---------CIDALRQLSGRLEALTMAYCRELTGTGLLQGLAGD 407
            .... |:.||| ...|::||:         | :||:.:..||..|.:|:.| |.|...:.|:.  
  Fly   414 NMHK-LQRLDLSSINVEMNASKSAVGVNSLC-NALQTMGSRLTHLYLAHNR-LAGIPQIVGIL-- 473

  Fly   408 INYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNLNIEY 472
                              |:.|      |||..|.|.|.....|...:..|.:.|...:.|.:  
  Fly   474 ------------------STHC------PNLTLLDLSNVTTQATSHGVLHIEKLQRGCQKLKV-- 512

  Fly   473 CMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVTDSSLMVGLKLPELRALSLGYCNRLTSEG 537
             :::|:..:     ||...|            .:.:.||.     ..|||..||:.   .||.|.
  Fly   513 -LRVTNSHI-----TPSTAS------------MQEIMDSP-----GFPELEELSVA---ALTDES 551

  Fly   538 FEALTQNCPSLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLTLQS--------IHHIL 594
                               ..:.|:.:..|:.:..:|::|::.|||:||.:|        |.|:.
  Fly   552 -------------------RIISDDHLQRILKSSSKLKLLDVRNCTRLTHESLIRLPAWDIKHLF 597

  Fly   595 AHGHNLVQLIACSIDGMDHEQAQRILESQR--PQMKQVLLXQERYIHXRSRNTP--HHNDWGNHE 655
            ..|.::.:.:...::.:..:.|..::|...  ..|:|.:....|.:..:.|::|  |.|..|:..
  Fly   598 LSGCSVTRDMGSGLELIASKWAHSLIELDLAWANMQQPIDNALRALAEKGRDSPLAHLNLCGSSV 662

  Fly   656 DDE 658
            .||
  Fly   663 SDE 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 4/13 (31%)
LRR_RI <297..482 CDD:238064 47/195 (24%)
leucine-rich repeat 304..330 CDD:275381 7/26 (27%)
leucine-rich repeat 331..357 CDD:275381 6/25 (24%)
leucine-rich repeat 358..379 CDD:275381 10/30 (33%)
leucine-rich repeat 384..409 CDD:275381 7/24 (29%)
leucine-rich repeat 412..437 CDD:275381 2/24 (8%)
AMN1 430..595 CDD:187754 36/172 (21%)
leucine-rich repeat 438..464 CDD:275381 7/25 (28%)
leucine-rich repeat 465..496 CDD:275381 5/30 (17%)
leucine-rich repeat 497..521 CDD:275381 2/23 (9%)
leucine-rich repeat 522..547 CDD:275381 6/24 (25%)
leucine-rich repeat 548..573 CDD:275381 2/24 (8%)
leucine-rich repeat 574..599 CDD:275381 11/32 (34%)
Fbl6NP_610665.2 F-box-like 293..341 CDD:289689
leucine-rich repeat 365..391 CDD:275381 7/29 (24%)
leucine-rich repeat 392..417 CDD:275381 7/27 (26%)
leucine-rich repeat 418..445 CDD:275381 8/27 (30%)
leucine-rich repeat 453..471 CDD:275381 6/18 (33%)
leucine-rich repeat 480..509 CDD:275381 7/28 (25%)
leucine-rich repeat 510..538 CDD:275381 7/52 (13%)
leucine-rich repeat 539..579 CDD:275381 12/61 (20%)
leucine-rich repeat 580..621 CDD:275381 7/40 (18%)
leucine-rich repeat 622..649 CDD:275381 4/26 (15%)
leucine-rich repeat 652..676 CDD:275381 5/14 (36%)
leucine-rich repeat 677..698 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13318
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.