DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and Fbxl7

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001102015.1 Gene:Fbxl7 / 361907 RGDID:1305813 Length:491 Species:Rattus norvegicus


Alignment Length:573 Identity:122/573 - (21%)
Similarity:214/573 - (37%) Gaps:202/573 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SIAAPPTPPPTP-----EKLDSDKDKEGSSKAAIELLPNEMWLEIMSYLSYNDLLQLRMVSWRCR 106
            ::|...:||||.     .:|.|...||   :|:|:.||:...::|.|:|..|.|         ||
  Rat    84 TVAMVHSPPPTRLTHPLIRLASRPQKE---QASIDRLPDHSMVQIFSFLPTNQL---------CR 136

  Fly   107 DLVHRRRFMEKGKVIVTQHNLEAIHKHAKGGNCYLSFERIELRNLRQCRQLENF---------LR 162
                                            |           .|.||:..|.         :|
  Rat   137 --------------------------------C-----------ARVCRRWYNLAWDPRLWRTIR 158

  Fly   163 LVGHEVKHLQVRHAPVFRNLDGKLPNLKVLTIATTMSMDDQHLAAMDDLDMKQFSHLVGFECDGV 227
            |.|..:            |:|..   |||||  ..:..|..::..|                   
  Rat   159 LTGETI------------NVDRA---LKVLT--RRLCQDTPNVCLM------------------- 187

  Fly   228 SLDAVLKMRMLLQLRRTENKVQLRHLQFEFRRNNENALLDVLQDHAETLVCVNLFFSCSPGIDTR 292
             |:.|:....                    ||..:..|..:.|              |.|     
  Rat   188 -LETVIVSGC--------------------RRLTDRGLYTIAQ--------------CCP----- 212

  Fly   293 EWCRAFENMHNLRTLKLSGNCHLVLLEAVLRAVPESAPIRQLDLTG-----MLSLTNELLLYVA- 351
                      .||.|::|| |:.:..|||...|.....:..||::|     .:|||.|..:.:: 
  Rat   213 ----------ELRRLEVSG-CYNISNEAVFDVVSLCPNLEHLDVSGCSKVTCISLTREASIKLSP 266

  Fly   352 --GKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTGLLQGLAGDINYSLQE 414
              || |.:::.||:..|..|....:..:           .|:|.:||                 .
  Rat   267 LHGK-QISIRYLDMTDCFVLEDEGLHTI-----------AAHCTQLT-----------------H 302

  Fly   415 LHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNLNIEYCMKITDQ 479
            |:|...:.|.:..:..|:....:::.||:.:|| .|:|..:..|.:.::|||.|:|.:|.:|||.
  Rat   303 LYLRRCVRLTDEGLRYLVIYCTSIKELSVSDCR-FVSDFGLREIAKLESRLRYLSIAHCGRITDV 366

  Fly   480 GLMGYGDTPYPISRLRGLKELNLRGCRNVTDSSL-MVGLKLPELRALSLGYCNRLTSEGFEALTQ 543
            |:.      |.......|:.||.|||..:||..: .:.....:|::|.:|.|..::..|.|:|..
  Rat   367 GIR------YVAKYCSKLRYLNARGCEGITDHGVEYLAKNCTKLKSLDIGKCPLVSDTGLESLAL 425

  Fly   544 NCPSLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAH 596
            ||.:|:.|.:.||.::..:.:..:.:|...|::||:.:| :::::::..:..|
  Rat   426 NCFNLKRLSLKSCESITGQGLQIVAANCFDLQMLNVQDC-EVSVEALRFVKRH 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040 10/41 (24%)
leucine-rich repeat 281..303 CDD:275381 2/21 (10%)
LRR_RI <297..482 CDD:238064 49/192 (26%)
leucine-rich repeat 304..330 CDD:275381 10/25 (40%)
leucine-rich repeat 331..357 CDD:275381 10/33 (30%)
leucine-rich repeat 358..379 CDD:275381 4/20 (20%)
leucine-rich repeat 384..409 CDD:275381 4/24 (17%)
leucine-rich repeat 412..437 CDD:275381 4/24 (17%)
AMN1 430..595 CDD:187754 45/165 (27%)
leucine-rich repeat 438..464 CDD:275381 7/25 (28%)
leucine-rich repeat 465..496 CDD:275381 10/30 (33%)
leucine-rich repeat 497..521 CDD:275381 8/24 (33%)
leucine-rich repeat 522..547 CDD:275381 9/24 (38%)
leucine-rich repeat 548..573 CDD:275381 5/24 (21%)
leucine-rich repeat 574..599 CDD:275381 5/23 (22%)
Fbxl7NP_001102015.1 F-box-like 114..160 CDD:289689 16/97 (16%)
leucine-rich repeat 129..151 CDD:275381 10/73 (14%)
leucine-rich repeat 154..187 CDD:275381 11/49 (22%)
AMN1 <185..366 CDD:187754 56/280 (20%)
leucine-rich repeat 188..213 CDD:275381 8/73 (11%)
leucine-rich repeat 214..234 CDD:275381 9/20 (45%)
leucine-rich repeat 240..273 CDD:275381 10/33 (30%)
leucine-rich repeat 274..299 CDD:275381 6/35 (17%)
AMN1 297..464 CDD:187754 50/190 (26%)
leucine-rich repeat 300..325 CDD:275381 6/41 (15%)
leucine-rich repeat 326..351 CDD:275381 7/25 (28%)
leucine-rich repeat 352..377 CDD:275381 10/30 (33%)
leucine-rich repeat 378..403 CDD:275381 8/24 (33%)
leucine-rich repeat 404..429 CDD:275381 9/24 (38%)
leucine-rich repeat 430..453 CDD:275381 4/22 (18%)
leucine-rich repeat 456..480 CDD:275381 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.