DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and CG9316

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_610051.2 Gene:CG9316 / 35333 FlyBaseID:FBgn0032878 Length:448 Species:Drosophila melanogaster


Alignment Length:643 Identity:120/643 - (18%)
Similarity:213/643 - (33%) Gaps:252/643 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ARSIAAP---------------PTPPPTP----EKLDSDKDKEGSSKAAIELLPNEMWLEIMSYL 90
            :||:..|               |:|.|:|    ..||..:|   ..:..:|.||.          
  Fly     8 SRSVKTPFPVRSNRPGGVQKSEPSPSPSPLCRTSLLDLPED---IIRLVLEFLPR---------- 59

  Fly    91 SYNDLLQLRMVSWRCRDLVHRRRFMEKGKVIVTQHNLEAIHKHAKGGNCYLSFERIELRNLRQCR 155
             ..|.:.|..|:.:.|...       :|...|.::.|:.:           |.|.:.|      .
  Fly    60 -ITDKVLLACVAPKFRAAF-------EGWARVQRNALDMV-----------SLETVPL------P 99

  Fly   156 QLENFLRLVGHEVKHLQV------RHAPVFRNLDGKLPNLKVLTIATTMSMDDQHLAAMDDLDMK 214
            ||..|.::.|..::.|||      :.:.:...:....|||:  .|:.:.:.|:.|..::    |.
  Fly   100 QLIRFFKVAGPFIRVLQVDCASYQKESLLVEFVKEYCPNLE--EISYSNATDEFHYRSI----MS 158

  Fly   215 QFSHL--VGFECDGVSLDAVLKMRMLLQLRRTENKVQLRHLQFEFRRNNENALLDVLQDHAETLV 277
            :.:||  |..||    |||             |:.     |.|:.:.|.|      |:       
  Fly   159 KMTHLKRVTIEC----LDA-------------EDV-----LNFDMQPNQE------LE------- 188

  Fly   278 CVNLFFSCSPGIDTREWCRAFENMHNLRTLKLSGNCHLVLLEAVL-RAVPESAPIRQLDLTGMLS 341
                ||....|      |...:|:.....||.     |||.:.:| .::....|::         
  Fly   189 ----FFELVNG------CYTGQNLCGFPNLKT-----LVLRDCLLWNSMEFGIPLK--------- 229

  Fly   342 LTNELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTGLLQGLAG 406
                           :|..|||..|                         |.|:....|.|.:|.
  Fly   230 ---------------SLHTLDLDDC-------------------------CFEVMNVSLYQKIAE 254

  Fly   407 DINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNLNIE 471
            ...      :|.|.||....:..:::..||.|.|.:|         :|..|       ...|||.
  Fly   255 SCT------NLVELIFSGCDTNFEVIANLPKLERCTL---------KTWMT-------SNELNIG 297

  Fly   472 YCMKITDQGLMGYGDTPYPISRLRG--LKELNLRGCRNVTDSSLMVGLKLPELRALSLGYCNRLT 534
            :...:.::               ||  |..|:|.|..|:|:.           .|..||..:.||
  Fly   298 FLTVLAEK---------------RGNKLTHLHLSGQFNITNE-----------HARCLGQLSSLT 336

  Fly   535 S--------------EGFEALTQNCPSLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKL 585
            .              :.|..|:|    ||...:::|..|.|..::.::....:|:|::|::|.::
  Fly   337 DLRFSNNDILDDDHFKFFNDLSQ----LERFGLTACGRVMDVGMMRMLRKCPQLKVIDLTDCEQI 397

  Fly   586 TLQSIHHILAHGHNLVQLIACSIDGMDHEQAQRILESQRPQMKQVLLXQERYIHXRSR 643
            |.:.:          :|.|.....|...:.   :|..:...:::.:|....|::..:|
  Fly   398 TEEFV----------IQAIGFCSKGSGRDV---VLNVKGTMIRRPILTHPDYVNSLNR 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040 7/41 (17%)
leucine-rich repeat 281..303 CDD:275381 5/21 (24%)
LRR_RI <297..482 CDD:238064 32/185 (17%)
leucine-rich repeat 304..330 CDD:275381 6/26 (23%)
leucine-rich repeat 331..357 CDD:275381 0/25 (0%)
leucine-rich repeat 358..379 CDD:275381 5/20 (25%)
leucine-rich repeat 384..409 CDD:275381 5/24 (21%)
leucine-rich repeat 412..437 CDD:275381 5/24 (21%)
AMN1 430..595 CDD:187754 36/180 (20%)
leucine-rich repeat 438..464 CDD:275381 5/25 (20%)
leucine-rich repeat 465..496 CDD:275381 3/30 (10%)
leucine-rich repeat 497..521 CDD:275381 6/23 (26%)
leucine-rich repeat 522..547 CDD:275381 8/38 (21%)
leucine-rich repeat 548..573 CDD:275381 5/24 (21%)
leucine-rich repeat 574..599 CDD:275381 5/24 (21%)
CG9316NP_610051.2 leucine-rich repeat 208..221 CDD:275381 6/17 (35%)
leucine-rich repeat 231..258 CDD:275381 10/57 (18%)
leucine-rich repeat 259..279 CDD:275381 5/19 (26%)
leucine-rich repeat 280..309 CDD:275381 10/59 (17%)
AMN1 310..>411 CDD:187754 26/125 (21%)
leucine-rich repeat 310..334 CDD:275381 9/34 (26%)
leucine-rich repeat 335..359 CDD:275381 4/23 (17%)
leucine-rich repeat 360..385 CDD:275381 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457960
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.