DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and fbxl14a

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_958890.1 Gene:fbxl14a / 333988 ZFINID:ZDB-GENE-030131-5920 Length:411 Species:Danio rerio


Alignment Length:359 Identity:92/359 - (25%)
Similarity:169/359 - (47%) Gaps:48/359 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 SCSPGIDTREWCRAFENMHNLRTLKLSGNCHLVLLEAVLRAVPESAPIRQLDLTGMLSLTNELLL 348
            |..|.:.||       .:..::.|.|..:     |..|::.:|.   |..|:|:|..:||:..|.
Zfish    60 SLFPSLQTR-------GIKKVQILSLRRS-----LSYVIQGMPN---IESLNLSGCYNLTDNGLG 109

  Fly   349 YVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTGLL---QGLAGDINY 410
            :...:...:|::|:|..|.|:..:.:..:.|....||.|.:..|..:|.||||   .||     :
Zfish   110 HAFVQDIPSLRILNLSLCKQITDSSLGRIAQYLKNLELLDLGGCSNITNTGLLLIAWGL-----H 169

  Fly   411 SLQELHLEETIFLDESSMCQL-------LERLPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNL 468
            :|:.|:|.....:.:..:..|       .|....|..|:|.:| |.:||.::..|.:...:|:.|
Zfish   170 NLKSLNLRSCRHVSDVGIGHLAGMTRSAAEGCLTLEHLTLQDC-QKLTDLSLKHISKGLNKLKVL 233

  Fly   469 NIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVTDSSLMVGLKLPELR--ALSLGYCN 531
            |:.:|..|:|.|::       .:|.:..|..||||.|.|::|:.:| .|.:..||  .|.:.:|:
Zfish   234 NLSFCGGISDAGMI-------HLSHMTQLWTLNLRSCDNISDTGIM-HLSMGALRLYGLDVSFCD 290

  Fly   532 RLTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAH 596
            ::..:....:.|....|::|.:.|| .:.|:.:..:|..:..|:.||:..|.::|.:.:..|..|
Zfish   291 KVGDQSLAYIAQGLYQLKSLSLCSC-HISDDGINRMVRQMHELKTLNIGQCVRITDKGLELIADH 354

  Fly   597 GHNLVQLIACSIDGMDHEQAQRILE--SQRPQMK 628
               |.||....:.|.. :..:|.||  :|.|.:|
Zfish   355 ---LTQLTGIDLYGCT-KITKRGLERITQLPCLK 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 4/18 (22%)
LRR_RI <297..482 CDD:238064 49/194 (25%)
leucine-rich repeat 304..330 CDD:275381 5/25 (20%)
leucine-rich repeat 331..357 CDD:275381 7/25 (28%)
leucine-rich repeat 358..379 CDD:275381 5/20 (25%)
leucine-rich repeat 384..409 CDD:275381 11/27 (41%)
leucine-rich repeat 412..437 CDD:275381 5/31 (16%)
AMN1 430..595 CDD:187754 45/173 (26%)
leucine-rich repeat 438..464 CDD:275381 8/25 (32%)
leucine-rich repeat 465..496 CDD:275381 8/30 (27%)
leucine-rich repeat 497..521 CDD:275381 10/23 (43%)
leucine-rich repeat 522..547 CDD:275381 5/26 (19%)
leucine-rich repeat 548..573 CDD:275381 6/24 (25%)
leucine-rich repeat 574..599 CDD:275381 7/24 (29%)
fbxl14aNP_958890.1 F-box-like 5..46 CDD:289689
AMN1 90..243 CDD:187754 43/161 (27%)
leucine-rich repeat 92..118 CDD:275381 7/25 (28%)
leucine-rich repeat 119..144 CDD:275381 6/24 (25%)
leucine-rich repeat 145..170 CDD:275381 11/29 (38%)
leucine-rich repeat 171..203 CDD:275381 5/31 (16%)
leucine-rich repeat 204..229 CDD:275381 8/25 (32%)
AMN1 230..397 CDD:187754 46/168 (27%)
leucine-rich repeat 230..254 CDD:275381 8/30 (27%)
leucine-rich repeat 255..280 CDD:275381 10/25 (40%)
leucine-rich repeat 281..304 CDD:275381 3/22 (14%)
leucine-rich repeat 307..331 CDD:275381 6/24 (25%)
leucine-rich repeat 332..357 CDD:275381 8/27 (30%)
leucine-rich repeat 358..377 CDD:275381 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.