DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and CG15056

DIOPT Version :10

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster


Alignment Length:321 Identity:67/321 - (20%)
Similarity:104/321 - (32%) Gaps:109/321 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 WQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYC--------RELTGTGLLQGLAG-DIN 409
            |...||.|||...:...|:| |....:..|...|.::..        ..|..|.|...|:| ||.
  Fly    16 WLDVLKQLDLKSRISFAASC-DMFENIYVRSSPLRLSRVVNLEEMIEFSLLETKLFVELSGSDIE 79

  Fly   410 ------YSLQELHLEETIFLDESSMCQLLE-------------------RLPNLRRLSLDNCRQA 449
                  ::....|.|:.|.|....:.::.|                   ...||..:||..|:  
  Fly    80 IIRGGPHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTYVSLRRCQ-- 142

  Fly   450 VTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVTDSSLM 514
            :.|..:.. .::.|.|..|::.|..::|...||.     .|.|    |..|.:.||||:..:.|:
  Fly   143 LNDENLVG-WEFLTHLETLDLRYNDRLTGSCLMS-----LPTS----LLSLYITGCRNLCPNQLI 197

  Fly   515 VGLKLPELRALSLGYCNRLTSEG----FEALTQNCPSLEALCVSSCMAVDDE------------- 562
            ...::|.||.|.   .:.|...|    :..|...||.|..:.:|.|....||             
  Fly   198 FLNRIPRLRELR---ASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELRYLQSLV 259

  Fly   563 ------------------------------------------TVLNIVSNLKRLRVLNLSN 581
                                                      ..|:|:|..::||||.:.|
  Fly   260 IKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPN 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:425796
leucine-rich repeat 281..303 CDD:275381
PPP1R42 <297..482 CDD:455733 34/161 (21%)
leucine-rich repeat 304..330 CDD:275381
leucine-rich repeat 331..357 CDD:275381 1/2 (50%)
leucine-rich repeat 358..379 CDD:275381 8/20 (40%)
leucine-rich repeat 384..409 CDD:275381 7/33 (21%)
leucine-rich repeat 412..437 CDD:275381 5/43 (12%)
AMN1 430..595 CDD:187754 45/230 (20%)
leucine-rich repeat 438..464 CDD:275381 5/25 (20%)
leucine-rich repeat 465..496 CDD:275381 8/30 (27%)
leucine-rich repeat 497..521 CDD:275381 7/23 (30%)
leucine-rich repeat 522..547 CDD:275381 7/28 (25%)
leucine-rich repeat 548..573 CDD:275381 8/79 (10%)
leucine-rich repeat 574..599 CDD:275381 5/8 (63%)
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 5/25 (20%)
leucine-rich repeat 157..179 CDD:275381 7/26 (27%)
leucine-rich repeat 180..204 CDD:275381 7/23 (30%)
leucine-rich repeat 205..231 CDD:275381 7/28 (25%)
leucine-rich repeat 232..285 CDD:275381 5/52 (10%)
leucine-rich repeat 286..326 CDD:275381 8/35 (23%)
AMN1 306..>376 CDD:187754 7/15 (47%)
leucine-rich repeat 337..362 CDD:275381
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.