DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and CG15056

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_573291.1 Gene:CG15056 / 32824 FlyBaseID:FBgn0030918 Length:399 Species:Drosophila melanogaster


Alignment Length:321 Identity:67/321 - (20%)
Similarity:104/321 - (32%) Gaps:109/321 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 WQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYC--------RELTGTGLLQGLAG-DIN 409
            |...||.|||...:...|:| |....:..|...|.::..        ..|..|.|...|:| ||.
  Fly    16 WLDVLKQLDLKSRISFAASC-DMFENIYVRSSPLRLSRVVNLEEMIEFSLLETKLFVELSGSDIE 79

  Fly   410 ------YSLQELHLEETIFLDESSMCQLLE-------------------RLPNLRRLSLDNCRQA 449
                  ::....|.|:.|.|....:.::.|                   ...||..:||..|:  
  Fly    80 IIRGGPHTPMFSHFEDFIRLMSIRLTKVNEIALEGFQLTQYKWFNAPETSFSNLTYVSLRRCQ-- 142

  Fly   450 VTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVTDSSLM 514
            :.|..:.. .::.|.|..|::.|..::|...||.     .|.|    |..|.:.||||:..:.|:
  Fly   143 LNDENLVG-WEFLTHLETLDLRYNDRLTGSCLMS-----LPTS----LLSLYITGCRNLCPNQLI 197

  Fly   515 VGLKLPELRALSLGYCNRLTSEG----FEALTQNCPSLEALCVSSCMAVDDE------------- 562
            ...::|.||.|.   .:.|...|    :..|...||.|..:.:|.|....||             
  Fly   198 FLNRIPRLRELR---ASDLMPGGHWHIYRDLVLACPLLVMVEISICSLNRDEYRLGELRYLQSLV 259

  Fly   563 ------------------------------------------TVLNIVSNLKRLRVLNLSN 581
                                                      ..|:|:|..::||||.:.|
  Fly   260 IKAHSTDTIRCKVSDWMLISLLDVPFLRNLMFSDAPSGFVSANALSIISRFRQLRVLKMPN 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381
LRR_RI <297..482 CDD:238064 34/161 (21%)
leucine-rich repeat 304..330 CDD:275381
leucine-rich repeat 331..357 CDD:275381 1/2 (50%)
leucine-rich repeat 358..379 CDD:275381 8/20 (40%)
leucine-rich repeat 384..409 CDD:275381 7/33 (21%)
leucine-rich repeat 412..437 CDD:275381 5/43 (12%)
AMN1 430..595 CDD:187754 45/230 (20%)
leucine-rich repeat 438..464 CDD:275381 5/25 (20%)
leucine-rich repeat 465..496 CDD:275381 8/30 (27%)
leucine-rich repeat 497..521 CDD:275381 7/23 (30%)
leucine-rich repeat 522..547 CDD:275381 7/28 (25%)
leucine-rich repeat 548..573 CDD:275381 8/79 (10%)
leucine-rich repeat 574..599 CDD:275381 5/8 (63%)
CG15056NP_573291.1 leucine-rich repeat 133..156 CDD:275381 5/25 (20%)
leucine-rich repeat 157..179 CDD:275381 7/26 (27%)
leucine-rich repeat 180..204 CDD:275381 7/23 (30%)
leucine-rich repeat 205..231 CDD:275381 7/28 (25%)
leucine-rich repeat 232..285 CDD:275381 5/52 (10%)
leucine-rich repeat 286..326 CDD:275381 8/35 (23%)
AMN1 306..>376 CDD:187754 7/15 (47%)
leucine-rich repeat 337..362 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457998
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.