Sequence 1: | NP_001303481.1 | Gene: | CG12402 / 41714 | FlyBaseID: | FBgn0038202 | Length: | 671 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_573291.1 | Gene: | CG15056 / 32824 | FlyBaseID: | FBgn0030918 | Length: | 399 | Species: | Drosophila melanogaster |
Alignment Length: | 321 | Identity: | 67/321 - (20%) |
---|---|---|---|
Similarity: | 104/321 - (32%) | Gaps: | 109/321 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 354 WQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYC--------RELTGTGLLQGLAG-DIN 409
Fly 410 ------YSLQELHLEETIFLDESSMCQLLE-------------------RLPNLRRLSLDNCRQA 449
Fly 450 VTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVTDSSLM 514
Fly 515 VGLKLPELRALSLGYCNRLTSEG----FEALTQNCPSLEALCVSSCMAVDDE------------- 562
Fly 563 ------------------------------------------TVLNIVSNLKRLRVLNLSN 581 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12402 | NP_001303481.1 | F-box | 75..117 | CDD:279040 | |
leucine-rich repeat | 281..303 | CDD:275381 | |||
LRR_RI | <297..482 | CDD:238064 | 34/161 (21%) | ||
leucine-rich repeat | 304..330 | CDD:275381 | |||
leucine-rich repeat | 331..357 | CDD:275381 | 1/2 (50%) | ||
leucine-rich repeat | 358..379 | CDD:275381 | 8/20 (40%) | ||
leucine-rich repeat | 384..409 | CDD:275381 | 7/33 (21%) | ||
leucine-rich repeat | 412..437 | CDD:275381 | 5/43 (12%) | ||
AMN1 | 430..595 | CDD:187754 | 45/230 (20%) | ||
leucine-rich repeat | 438..464 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 465..496 | CDD:275381 | 8/30 (27%) | ||
leucine-rich repeat | 497..521 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 522..547 | CDD:275381 | 7/28 (25%) | ||
leucine-rich repeat | 548..573 | CDD:275381 | 8/79 (10%) | ||
leucine-rich repeat | 574..599 | CDD:275381 | 5/8 (63%) | ||
CG15056 | NP_573291.1 | leucine-rich repeat | 133..156 | CDD:275381 | 5/25 (20%) |
leucine-rich repeat | 157..179 | CDD:275381 | 7/26 (27%) | ||
leucine-rich repeat | 180..204 | CDD:275381 | 7/23 (30%) | ||
leucine-rich repeat | 205..231 | CDD:275381 | 7/28 (25%) | ||
leucine-rich repeat | 232..285 | CDD:275381 | 5/52 (10%) | ||
leucine-rich repeat | 286..326 | CDD:275381 | 8/35 (23%) | ||
AMN1 | 306..>376 | CDD:187754 | 7/15 (47%) | ||
leucine-rich repeat | 337..362 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45457998 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |