DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and Fbxl17

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:XP_038939705.1 Gene:Fbxl17 / 316663 RGDID:1309773 Length:739 Species:Rattus norvegicus


Alignment Length:331 Identity:72/331 - (21%)
Similarity:154/331 - (46%) Gaps:50/331 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 NCHLVLLEAVLRAVPESAP-IRQLDLTGMLSLTNELLL--------YVAGKWQSTLKVLDLMFCV 367
            :||        |..|...| |.||..:.:|.:.:.|.|        .|...|:..  .||..|..
  Rat   304 DCH--------REPPPEIPDINQLPPSILLKIFSNLSLDERCLSASLVCKYWRDL--CLDFQFWK 358

  Fly   368 QLNANCIDALRQLSGRLEALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLL 432
            ||:         ||.|         :::|.. ||:.:|.. :.::.|:::.:...:.:|.:|.|.
  Rat   359 QLD---------LSSR---------QQVTDE-LLEKIASR-SQNIVEINISDCRSMSDSGVCVLA 403

  Fly   433 ERLPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGL 497
            .:.|.|.|.:...|:| ::|.::..:..:...|:.:::....|:||:||...|      |:.|.|
  Rat   404 FKCPGLLRYTAYRCKQ-LSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLG------SKCREL 461

  Fly   498 KELNLRGCRNVTDSSLMVGLK-LPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDD 561
            |:::...|..::|..::|..| ..:|:.:.:.....:|.:..:|..::||.|:.:....| :|..
  Rat   462 KDIHFGQCYKISDEGMVVIAKSCLKLQRIYMQENKLVTDQSVKAFAEHCPDLQCVGFMGC-SVTS 525

  Fly   562 ETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNLVQLIACSIDGMDHEQAQRILESQRPQ 626
            :.|::: :.|:.|..|:|.:.|:|..:::..|:....||..|..| ::.:.:::...::..:...
  Rat   526 KGVIHL-TKLRNLSSLDLRHITELDNETVMEIVKRCKNLSSLNLC-LNWIINDRCVEVIAKEGQS 588

  Fly   627 MKQVLL 632
            :|::.|
  Rat   589 LKELYL 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381
LRR_RI <297..482 CDD:238064 40/178 (22%)
leucine-rich repeat 304..330 CDD:275381 4/17 (24%)
leucine-rich repeat 331..357 CDD:275381 8/33 (24%)
leucine-rich repeat 358..379 CDD:275381 5/20 (25%)
leucine-rich repeat 384..409 CDD:275381 4/24 (17%)
leucine-rich repeat 412..437 CDD:275381 4/24 (17%)
AMN1 430..595 CDD:187754 38/165 (23%)
leucine-rich repeat 438..464 CDD:275381 5/25 (20%)
leucine-rich repeat 465..496 CDD:275381 8/30 (27%)
leucine-rich repeat 497..521 CDD:275381 6/24 (25%)
leucine-rich repeat 522..547 CDD:275381 4/24 (17%)
leucine-rich repeat 548..573 CDD:275381 5/24 (21%)
leucine-rich repeat 574..599 CDD:275381 6/24 (25%)
Fbxl17XP_038939705.1 F-box-like 316..361 CDD:403981 12/46 (26%)
leucine-rich repeat 357..382 CDD:275381 9/44 (20%)
leucine-rich repeat 383..408 CDD:275381 4/24 (17%)
AMN1 406..568 CDD:187754 40/170 (24%)
leucine-rich repeat 409..434 CDD:275381 5/25 (20%)
leucine-rich repeat 435..460 CDD:275381 8/30 (27%)
leucine-rich repeat 461..486 CDD:275381 6/24 (25%)
leucine-rich repeat 487..512 CDD:275381 4/24 (17%)
leucine-rich repeat 513..536 CDD:275381 5/24 (21%)
leucine-rich repeat 537..562 CDD:275381 6/24 (25%)
leucine-rich repeat 563..588 CDD:275381 3/25 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.