DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and Fbxl4

DIOPT Version :10

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_001382505.1 Gene:Fbxl4 / 313101 RGDID:1305724 Length:621 Species:Rattus norvegicus


Alignment Length:543 Identity:119/543 - (21%)
Similarity:207/543 - (38%) Gaps:143/543 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 VIVTQHNLEAIHKHAKGGNCYLSFERIELR------------NLRQCRQLE----------NFLR 162
            |:.|.|....|...|...|.|......|:|            |..|.||.:          |.:|
  Rat   142 VLETYHPGAVIRILACSANPYSPNPPAEVRWETLWSERPTKVNASQARQFKPRIKQINFPTNLIR 206

  Fly   163 LVGHEVKHLQVRHAPVFRNLDGKL----PNLKVLTIATTMSMDDQHLAAMDDLDMKQFSHLVGFE 223
            |   ||....:.:   :..||..:    .:..:|::.|.       |..|:||:...:.     |
  Rat   207 L---EVNSSLLDY---YTELDAVVLHGTKDKPLLSLKTA-------LVDMNDLEDDDYE-----E 253

  Fly   224 CDGVSLDAVLKMRMLLQLRRTENKVQLRHLQFEFRRNNENALLDVLQDH---------AETLVCV 279
            .||..:||:.|......|....:......|.:|        |:.::.:|         |:|  |.
  Rat   254 KDGCEMDALNKKFSSATLGDGPSNGYFDKLPYE--------LIQLILNHLSLPDLCRLAQT--CR 308

  Fly   280 NLFFSCSPGIDTREWCRAFENMH-NLRT--LKLSGNCHLVLLEAVLRAVPESAPIRQLDLT---- 337
            .|...|         |...:.:| ||:.  .||. :..|..|:|      ..|.::.|:|:    
  Rat   309 LLHQHC---------CDPLQYIHLNLQPYWAKLD-DTSLEFLQA------RCALVQWLNLSWTGN 357

  Fly   338 -GMLSLTN-ELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTGL 400
             |.:|::. ...|.|.|   |.|..|:|.....||..|::.:.::...|:.|.::.|.:|.....
  Rat   358 RGFISVSGFSRFLKVCG---SELVRLELSCSHFLNDACLEVISEMCPNLQDLNLSSCDKLPPQAF 419

  Fly   401 LQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQAVTDRTMATICQYQTRL 465
                 |.|                        .:|.:|:||.|  .|..|....:.:|..:...|
  Rat   420 -----GHI------------------------AKLRSLKRLIL--YRTKVEQTALLSILNFCAEL 453

  Fly   466 RNLNIEYCMKITD----QGLMGYGDTPYPISRLRGLKELNLRGCRNVTD---SSLMVGLKLPELR 523
            ::|::..|:.|.|    ..::|        ::.:.|:.|:|..|:|:|:   :.|..|..|  |.
  Rat   454 QHLSLGSCVMIEDYDVIASMIG--------AKCKSLRTLDLWRCKNITENGIAELASGCAL--LE 508

  Fly   524 ALSLGYCNRLTSEG--FEALTQNCPSLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLT 586
            .|.||:|..|.|..  |..|.:..|:|:.|.:::..:|.|..:..:.||..||:.|::.....::
  Rat   509 ELDLGWCPTLQSSTGCFARLARQLPNLQKLFLTANRSVCDTDIEELASNCTRLQQLDILGTRMVS 573

  Fly   587 LQSIHHIL--AHGHNLVQLIACS 607
            ..|:..:|  ....:|:.:..||
  Rat   574 PASLRKLLESCKDLSLLDVSFCS 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:425796
leucine-rich repeat 281..303 CDD:275381 4/22 (18%)
PPP1R42 <297..482 CDD:455733 42/197 (21%)
leucine-rich repeat 304..330 CDD:275381 6/27 (22%)
leucine-rich repeat 331..357 CDD:275381 7/31 (23%)
leucine-rich repeat 358..379 CDD:275381 6/20 (30%)
leucine-rich repeat 384..409 CDD:275381 5/24 (21%)
leucine-rich repeat 412..437 CDD:275381 1/24 (4%)
AMN1 430..595 CDD:187754 44/175 (25%)
leucine-rich repeat 438..464 CDD:275381 7/25 (28%)
leucine-rich repeat 465..496 CDD:275381 6/34 (18%)
leucine-rich repeat 497..521 CDD:275381 9/26 (35%)
leucine-rich repeat 522..547 CDD:275381 9/26 (35%)
leucine-rich repeat 548..573 CDD:275381 6/24 (25%)
leucine-rich repeat 574..599 CDD:275381 4/26 (15%)
Fbxl4NP_001382505.1 F-box_FBXL4 280..326 CDD:438889 12/64 (19%)
leucine-rich repeat 295..317 CDD:275381 6/32 (19%)
leucine-rich repeat 318..340 CDD:275381 6/22 (27%)
leucine-rich repeat 347..376 CDD:275381 7/31 (23%)
leucine-rich repeat 377..402 CDD:275381 6/24 (25%)
AMN1 394..601 CDD:187754 53/244 (22%)
leucine-rich repeat 403..427 CDD:275381 7/52 (13%)
leucine-rich repeat 428..452 CDD:275381 7/25 (28%)
leucine-rich repeat 453..480 CDD:275381 6/34 (18%)
leucine-rich repeat 481..506 CDD:275381 8/24 (33%)
leucine-rich repeat 507..534 CDD:275381 9/26 (35%)
leucine-rich repeat 535..560 CDD:275381 6/24 (25%)
leucine-rich repeat 561..586 CDD:275381 4/24 (17%)
leucine-rich repeat 587..612 CDD:275381 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.