Sequence 1: | NP_001303481.1 | Gene: | CG12402 / 41714 | FlyBaseID: | FBgn0038202 | Length: | 671 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001101073.1 | Gene: | Fbxl15 / 309453 | RGDID: | 1306444 | Length: | 300 | Species: | Rattus norvegicus |
Alignment Length: | 272 | Identity: | 73/272 - (26%) |
---|---|---|---|
Similarity: | 113/272 - (41%) | Gaps: | 31/272 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 327 ESAPIRQLDLTGMLSLTNELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQLS-GRLEALTMA 390
Fly 391 YCRELTGTGLLQGLAGDINYSLQELHLE--ETIFLDESSMCQLLERLPNLRRLSLDNCRQAVTDR 453
Fly 454 TMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVTDSSL--MVG 516
Fly 517 LKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSN 581
Fly 582 CTKLTLQSIHHI 593 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12402 | NP_001303481.1 | F-box | 75..117 | CDD:279040 | |
leucine-rich repeat | 281..303 | CDD:275381 | |||
LRR_RI | <297..482 | CDD:238064 | 41/157 (26%) | ||
leucine-rich repeat | 304..330 | CDD:275381 | 1/2 (50%) | ||
leucine-rich repeat | 331..357 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 358..379 | CDD:275381 | 5/20 (25%) | ||
leucine-rich repeat | 384..409 | CDD:275381 | 5/24 (21%) | ||
leucine-rich repeat | 412..437 | CDD:275381 | 10/26 (38%) | ||
AMN1 | 430..595 | CDD:187754 | 44/166 (27%) | ||
leucine-rich repeat | 438..464 | CDD:275381 | 6/25 (24%) | ||
leucine-rich repeat | 465..496 | CDD:275381 | 6/30 (20%) | ||
leucine-rich repeat | 497..521 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 522..547 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 548..573 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 574..599 | CDD:275381 | 6/20 (30%) | ||
Fbxl15 | NP_001101073.1 | F-box | 18..55 | CDD:395521 | 11/45 (24%) |
leucine-rich repeat | 62..88 | CDD:275381 | 5/26 (19%) | ||
leucine-rich repeat | 89..115 | CDD:275381 | 10/26 (38%) | ||
Interaction with SMURF1. /evidence=ECO:0000250 | 113..269 | 42/161 (26%) | |||
leucine-rich repeat | 116..141 | CDD:275381 | 6/25 (24%) | ||
AMN1 | <139..>268 | CDD:187754 | 35/134 (26%) | ||
leucine-rich repeat | 142..167 | CDD:275381 | 6/30 (20%) | ||
leucine-rich repeat | 168..194 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 195..220 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 221..245 | CDD:275381 | 6/23 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR13318 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |