| Sequence 1: | NP_001303481.1 | Gene: | CG12402 / 41714 | FlyBaseID: | FBgn0038202 | Length: | 671 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_038937.2 | Gene: | Fbxl6 / 30840 | MGIID: | 1354705 | Length: | 535 | Species: | Mus musculus |
| Alignment Length: | 323 | Identity: | 75/323 - (23%) |
|---|---|---|---|
| Similarity: | 110/323 - (34%) | Gaps: | 106/323 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 304 LRTLKLSGNCHLVLLEAVLRAVPESAPIRQLDL-------TGMLSLTNELLLYVAGKW----QST 357
Fly 358 LKVLDLMF---CVQLNA-------NC--------IDALRQLSGRLEA---LTMAYCRELTGTGLL 401
Fly 402 QGLAGDINYSLQELHLEETI--FLDESSMCQLLERLPNLRRLSLDNCRQAVTDRTMATICQ---- 460
Fly 461 --------------------------YQTRLRNLNIE---YCMKITDQGLMGYGDTP---YPISR 493
Fly 494 LRGLKELNLRGCRNVTDSSLMVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSC 556 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12402 | NP_001303481.1 | F-box | 75..117 | CDD:279040 | |
| leucine-rich repeat | 281..303 | CDD:275381 | |||
| LRR_RI | <297..482 | CDD:238064 | 55/244 (23%) | ||
| leucine-rich repeat | 304..330 | CDD:275381 | 9/25 (36%) | ||
| leucine-rich repeat | 331..357 | CDD:275381 | 7/36 (19%) | ||
| leucine-rich repeat | 358..379 | CDD:275381 | 8/38 (21%) | ||
| leucine-rich repeat | 384..409 | CDD:275381 | 6/27 (22%) | ||
| leucine-rich repeat | 412..437 | CDD:275381 | 8/26 (31%) | ||
| AMN1 | 430..595 | CDD:187754 | 38/163 (23%) | ||
| leucine-rich repeat | 438..464 | CDD:275381 | 8/55 (15%) | ||
| leucine-rich repeat | 465..496 | CDD:275381 | 9/36 (25%) | ||
| leucine-rich repeat | 497..521 | CDD:275381 | 10/23 (43%) | ||
| leucine-rich repeat | 522..547 | CDD:275381 | 1/24 (4%) | ||
| leucine-rich repeat | 548..573 | CDD:275381 | 4/9 (44%) | ||
| leucine-rich repeat | 574..599 | CDD:275381 | |||
| Fbxl6 | NP_038937.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..25 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 61..99 | ||||
| F-box-like | 105..155 | CDD:289689 | |||
| LRR 1 | 169..195 | ||||
| AMN1 | 171..390 | CDD:187754 | 46/179 (26%) | ||
| leucine-rich repeat | 188..213 | CDD:275381 | |||
| LRR 2 | 196..221 | 5/7 (71%) | |||
| leucine-rich repeat | 214..239 | CDD:275381 | 9/25 (36%) | ||
| LRR 3 | 222..247 | 7/24 (29%) | |||
| leucine-rich repeat | 240..291 | CDD:275381 | 10/50 (20%) | ||
| LRR 4 | 273..299 | 5/25 (20%) | |||
| leucine-rich repeat | 292..321 | CDD:275381 | 5/28 (18%) | ||
| LRR 5 | 304..329 | 3/24 (13%) | |||
| leucine-rich repeat | 322..349 | CDD:275381 | 6/29 (21%) | ||
| LRR 6 | 330..357 | 9/29 (31%) | |||
| AMN1 | <349..500 | CDD:187754 | 42/182 (23%) | ||
| leucine-rich repeat | 350..377 | CDD:275381 | 8/26 (31%) | ||
| LRR 7 | 360..385 | 9/24 (38%) | |||
| leucine-rich repeat | 378..401 | CDD:275381 | 6/22 (27%) | ||
| LRR 8 | 386..411 | 3/24 (13%) | |||
| LRR 9 | 415..441 | 5/26 (19%) | |||
| leucine-rich repeat | 434..466 | CDD:275381 | 9/36 (25%) | ||
| leucine-rich repeat | 467..491 | CDD:275381 | 11/49 (22%) | ||
| LRR 10 | 474..499 | 9/50 (18%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||