Sequence 1: | NP_001303481.1 | Gene: | CG12402 / 41714 | FlyBaseID: | FBgn0038202 | Length: | 671 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001106873.1 | Gene: | AMN1 / 196394 | HGNCID: | 27281 | Length: | 258 | Species: | Homo sapiens |
Alignment Length: | 251 | Identity: | 66/251 - (26%) |
---|---|---|---|
Similarity: | 104/251 - (41%) | Gaps: | 64/251 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 401 LQGLAGDINYSLQELHLE-ETIFLDESSMCQLLERLPNLRRLSLDNCRQAVTDRTMATICQYQTR 464
Fly 465 LRNLNIEYC----MKITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVTDSSLM-VGLKLPELRA 524
Fly 525 LSLGYCNRLTSEGFEALTQNCPSLEALCVS-SCMAVDDETVLNIVSN--LKRLRVLNLSNCTKLT 586
Fly 587 ----------LQSIHHILAHGHNLVQLIACSIDGMDHEQAQRILES--QRPQMKQV 630 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12402 | NP_001303481.1 | F-box | 75..117 | CDD:279040 | |
leucine-rich repeat | 281..303 | CDD:275381 | |||
LRR_RI | <297..482 | CDD:238064 | 21/85 (25%) | ||
leucine-rich repeat | 304..330 | CDD:275381 | |||
leucine-rich repeat | 331..357 | CDD:275381 | |||
leucine-rich repeat | 358..379 | CDD:275381 | |||
leucine-rich repeat | 384..409 | CDD:275381 | 3/7 (43%) | ||
leucine-rich repeat | 412..437 | CDD:275381 | 6/25 (24%) | ||
AMN1 | 430..595 | CDD:187754 | 44/182 (24%) | ||
leucine-rich repeat | 438..464 | CDD:275381 | 5/25 (20%) | ||
leucine-rich repeat | 465..496 | CDD:275381 | 6/34 (18%) | ||
leucine-rich repeat | 497..521 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 522..547 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 548..573 | CDD:275381 | 9/27 (33%) | ||
leucine-rich repeat | 574..599 | CDD:275381 | 8/34 (24%) | ||
AMN1 | NP_001106873.1 | AMN1 | 37..257 | CDD:187754 | 66/251 (26%) |
leucine-rich repeat | 63..86 | CDD:275381 | 8/45 (18%) | ||
leucine-rich repeat | 87..116 | CDD:275381 | 6/34 (18%) | ||
leucine-rich repeat | 117..142 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 143..168 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 169..195 | CDD:275381 | 9/27 (33%) | ||
leucine-rich repeat | 196..221 | CDD:275381 | 4/24 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |