DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and B0393.3

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_497980.1 Gene:B0393.3 / 175630 WormBaseID:WBGene00007168 Length:621 Species:Caenorhabditis elegans


Alignment Length:405 Identity:92/405 - (22%)
Similarity:160/405 - (39%) Gaps:122/405 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 EFRRNN-----ENALLDVLQDHAETLVCVNLFFSCSPGIDTREWCRAFENMHNLRTLKLSGNCHL 315
            ||.:|:     ::::||::.:|.             |..|              |.|||...||.
 Worm    28 EFVQNSALLQLKDSILDIIVEHV-------------PLKD--------------RLLKLRPVCHR 65

  Fly   316 VLLEAVLRAVPESAPIR-QLDLTGMLSLTNELLLYVAGK----------------------WQST 357
             |.::|.|:|.....:| :||......::..|.:|  ||                      |:.:
 Worm    66 -LSDSVKRSVKSVEFLRDELDYCDDAKISFFLAVY--GKNVQHMNYDLFRSCSLREYTQWSWRQS 127

  Fly   358 ----------LKVLDLMFCVQ---------------------------LNANCIDALRQLSGRLE 385
                      ||.||::.|.:                           :|.:|.....|...:||
 Worm   128 VISSVTRCPQLKQLDILICCRHRLRDGDLQVIFKQCNQLEELRMDASYINGHCFSKAPQTLRKLE 192

  Fly   386 ALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCR--- 447
               :..|:.|...|.: |:...: :.||.||:.....:||    ||::|:.:::  ||.|..   
 Worm   193 ---LECCQTLNKQGFI-GMCSRL-FKLQTLHVSLMQCIDE----QLIKRIGDMK--SLKNLSVVA 246

  Fly   448 ---QAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGD---TPYPISRLRGLKELNLRGCR 506
               |.:....:|.| :..::|..|.::....:||:.|....|   :|...|    ::.|:|..|:
 Worm   247 DPDQKMNQFRLAEI-RRLSKLTTLCLDGVNNVTDKFLGDLSDLSTSPAGSS----IEHLSLSFCK 306

  Fly   507 NVTDSSLMVGLKLPELRALSL-GYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNIVSN 570
            |:..:.:.....||.|::|:| |...|..|.|.||:.| ...||.|.||....|:.:|:...|:.
 Worm   307 NIGSNGISKLKTLPNLKSLNLDGVSKRDISTGLEAIGQ-AGRLERLLVSEDTYVNPKTIAEFVNT 370

  Fly   571 LKRLRVLNLSNCTKL 585
            .:.||.|::|...:|
 Worm   371 CESLRTLDISGNHRL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 2/21 (10%)
LRR_RI <297..482 CDD:238064 51/250 (20%)
leucine-rich repeat 304..330 CDD:275381 10/25 (40%)
leucine-rich repeat 331..357 CDD:275381 8/48 (17%)
leucine-rich repeat 358..379 CDD:275381 7/47 (15%)
leucine-rich repeat 384..409 CDD:275381 6/24 (25%)
leucine-rich repeat 412..437 CDD:275381 9/24 (38%)
AMN1 430..595 CDD:187754 46/166 (28%)
leucine-rich repeat 438..464 CDD:275381 6/31 (19%)
leucine-rich repeat 465..496 CDD:275381 8/33 (24%)
leucine-rich repeat 497..521 CDD:275381 5/23 (22%)
leucine-rich repeat 522..547 CDD:275381 10/25 (40%)
leucine-rich repeat 548..573 CDD:275381 8/24 (33%)
leucine-rich repeat 574..599 CDD:275381 5/12 (42%)
B0393.3NP_497980.1 leucine-rich repeat 103..137 CDD:275381 1/33 (3%)
leucine-rich repeat 138..165 CDD:275381 5/26 (19%)
leucine-rich repeat 188..213 CDD:275381 6/29 (21%)
leucine-rich repeat 214..265 CDD:275381 15/57 (26%)
LRR 232..>389 CDD:227223 44/162 (27%)
AMN1 <262..408 CDD:187754 37/129 (29%)
leucine-rich repeat 266..296 CDD:275381 7/29 (24%)
leucine-rich repeat 297..321 CDD:275381 5/23 (22%)
leucine-rich repeat 348..373 CDD:275381 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.