DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and FBXO39

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_694962.1 Gene:FBXO39 / 162517 HGNCID:28565 Length:442 Species:Homo sapiens


Alignment Length:437 Identity:89/437 - (20%)
Similarity:156/437 - (35%) Gaps:137/437 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 CRAFENM------HNLRTLKLSGNCHLVLLEAVLRAV---------PESAPIRQLD-----LTGM 339
            ||.:..|      ...||:..||....|....|..||         .|...::.::     ||..
Human    43 CRKWNQMMYSAELWRYRTITFSGRPSRVHASEVESAVWYVKKFGRYLEHLEVKFMNPYNAVLTKK 107

  Fly   340 LSLTNELLLYVAGKWQSTLKVLDLMFCVQLN----ANCIDA---------LRQLSGRLEALTMAY 391
            ..:|...||....|..:.||.|.:.: ::|:    .|.|.:         |:::..||:.|.:..
Human   108 FQVTMRGLLSCLSKSNNRLKSLSIQY-LELDRLVWRNSIRSSFISSLSFFLKKMGKRLDYLNLKG 171

  Fly   392 CRELT---GTGLLQGLAGDINYS-LQELHLEE-----TIFLDESSMCQLLERLPNLRRLSLD-NC 446
            .| ||   |..:|..|:...|.: :.||::|:     ....:.....:.:....||..|:|: ||
Human   172 AR-LTVEQGCQILDSLSYMRNENVISELNIEDYFSHHLAVYNSPQFKKTMSTFHNLVSLNLNYNC 235

  Fly   447 RQAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLR---------------- 495
               ::|..:..:|:..:.||.:||: |......|.:.:|.:...::|..                
Human   236 ---ISDELLENLCENASTLRTINIK-CHVHDPHGQVIWGMSWAKLARQATNLKVNFFFERIMKYE 296

  Fly   496 ----------GLKELNLRGCR-NVTDSSL---MVGLKLPELRALSLGYCNRLTSEGFEALTQNCP 546
                      .::.::||.|. :..|.|:   ::.| ||..|..    ..:||.|    ...|..
Human   297 RLARILLQEIPIRSISLRSCYFSDPDCSMRPTLIDL-LPTFRHT----LQKLTCE----FNNNHE 352

  Fly   547 SLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNLVQLIACSIDGM 611
            ||           |:|..|.|:|            |.||....|...|                 
Human   353 SL-----------DEELHLLIIS------------CRKLFYFKIWAFL----------------- 377

  Fly   612 DHEQAQRILESQRPQMKQVLLXQERYIHXRSRNTPHHNDWGNHEDDE 658
            |....:|||:||:.:...:.: :.|.         :.|.:..:|:|:
Human   378 DVSFVERILKSQKERQCALRVFKARI---------YTNRYETNEEDK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 3/13 (23%)
LRR_RI <297..482 CDD:238064 50/227 (22%)
leucine-rich repeat 304..330 CDD:275381 9/34 (26%)
leucine-rich repeat 331..357 CDD:275381 6/30 (20%)
leucine-rich repeat 358..379 CDD:275381 7/33 (21%)
leucine-rich repeat 384..409 CDD:275381 8/27 (30%)
leucine-rich repeat 412..437 CDD:275381 3/29 (10%)
AMN1 430..595 CDD:187754 40/195 (21%)
leucine-rich repeat 438..464 CDD:275381 7/26 (27%)
leucine-rich repeat 465..496 CDD:275381 8/56 (14%)
leucine-rich repeat 497..521 CDD:275381 7/27 (26%)
leucine-rich repeat 522..547 CDD:275381 5/24 (21%)
leucine-rich repeat 548..573 CDD:275381 6/24 (25%)
leucine-rich repeat 574..599 CDD:275381 5/24 (21%)
FBXO39NP_694962.1 F-box-like 16..57 CDD:289689 3/13 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.