| Sequence 1: | NP_001303481.1 | Gene: | CG12402 / 41714 | FlyBaseID: | FBgn0038202 | Length: | 671 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_699181.2 | Gene: | FBXL16 / 146330 | HGNCID: | 14150 | Length: | 479 | Species: | Homo sapiens |
| Alignment Length: | 239 | Identity: | 72/239 - (30%) |
|---|---|---|---|
| Similarity: | 113/239 - (47%) | Gaps: | 25/239 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 377 LRQLSG--RLEALTMAYCRELTGTGLLQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLR 439
Fly 440 RLSLDNCRQA--VTDRTMATICQYQTR-LRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKELN 501
Fly 502 LRGCRNVTDSSL-MVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVL 565
Fly 566 NIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGH-NLVQLIACSI 608 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG12402 | NP_001303481.1 | F-box | 75..117 | CDD:279040 | |
| leucine-rich repeat | 281..303 | CDD:275381 | |||
| LRR_RI | <297..482 | CDD:238064 | 33/109 (30%) | ||
| leucine-rich repeat | 304..330 | CDD:275381 | |||
| leucine-rich repeat | 331..357 | CDD:275381 | |||
| leucine-rich repeat | 358..379 | CDD:275381 | 1/1 (100%) | ||
| leucine-rich repeat | 384..409 | CDD:275381 | 7/24 (29%) | ||
| leucine-rich repeat | 412..437 | CDD:275381 | 3/24 (13%) | ||
| AMN1 | 430..595 | CDD:187754 | 52/168 (31%) | ||
| leucine-rich repeat | 438..464 | CDD:275381 | 11/27 (41%) | ||
| leucine-rich repeat | 465..496 | CDD:275381 | 6/30 (20%) | ||
| leucine-rich repeat | 497..521 | CDD:275381 | 10/24 (42%) | ||
| leucine-rich repeat | 522..547 | CDD:275381 | 8/24 (33%) | ||
| leucine-rich repeat | 548..573 | CDD:275381 | 8/24 (33%) | ||
| leucine-rich repeat | 574..599 | CDD:275381 | 9/25 (36%) | ||
| FBXL16 | NP_699181.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..62 | ||
| AMN1 | 201..413 | CDD:332986 | 65/216 (30%) | ||
| leucine-rich repeat | 220..243 | CDD:275381 | 8/25 (32%) | ||
| leucine-rich repeat | 244..269 | CDD:275381 | 4/28 (14%) | ||
| LRR 1 | 244..266 | 3/25 (12%) | |||
| LRR 2 | 267..290 | 13/26 (50%) | |||
| leucine-rich repeat | 270..295 | CDD:275381 | 11/28 (39%) | ||
| leucine-rich repeat | 296..321 | CDD:275381 | 6/30 (20%) | ||
| LRR 3 | 319..343 | 10/23 (43%) | |||
| leucine-rich repeat | 322..347 | CDD:275381 | 10/24 (42%) | ||
| LRR 4 | 345..369 | 9/23 (39%) | |||
| leucine-rich repeat | 348..373 | CDD:275381 | 8/24 (33%) | ||
| LRR 5 | 371..395 | 7/24 (29%) | |||
| leucine-rich repeat | 374..398 | CDD:275381 | 8/24 (33%) | ||
| LRR 6 | 396..420 | 6/23 (26%) | |||
| LRR 7 | 446..470 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||