Sequence 1: | NP_001303481.1 | Gene: | CG12402 / 41714 | FlyBaseID: | FBgn0038202 | Length: | 671 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_689654.1 | Gene: | FBXL14 / 144699 | HGNCID: | 28624 | Length: | 418 | Species: | Homo sapiens |
Alignment Length: | 307 | Identity: | 84/307 - (27%) |
---|---|---|---|
Similarity: | 147/307 - (47%) | Gaps: | 29/307 - (9%) |
- Green bases have known domain annotations that are detailed below.
Fly 315 LVLLEAVLRAVPESAPIRQLDLTGMLSLTNELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQ 379
Fly 380 LSGRLEALTMAYCRELTGTGLLQGLAGDINYSLQEL---------HLEETIFLDESSMCQ-LLER 434
Fly 435 LPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKE 499
Fly 500 LNLRGCRNVTDSSLMVGLKLPELR--ALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDE 562
Fly 563 TVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNL--VQLIACS 607 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12402 | NP_001303481.1 | F-box | 75..117 | CDD:279040 | |
leucine-rich repeat | 281..303 | CDD:275381 | |||
LRR_RI | <297..482 | CDD:238064 | 50/176 (28%) | ||
leucine-rich repeat | 304..330 | CDD:275381 | 2/14 (14%) | ||
leucine-rich repeat | 331..357 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 358..379 | CDD:275381 | 5/20 (25%) | ||
leucine-rich repeat | 384..409 | CDD:275381 | 9/24 (38%) | ||
leucine-rich repeat | 412..437 | CDD:275381 | 7/34 (21%) | ||
AMN1 | 430..595 | CDD:187754 | 48/167 (29%) | ||
leucine-rich repeat | 438..464 | CDD:275381 | 8/25 (32%) | ||
leucine-rich repeat | 465..496 | CDD:275381 | 10/30 (33%) | ||
leucine-rich repeat | 497..521 | CDD:275381 | 10/23 (43%) | ||
leucine-rich repeat | 522..547 | CDD:275381 | 5/26 (19%) | ||
leucine-rich repeat | 548..573 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 574..599 | CDD:275381 | 8/24 (33%) | ||
FBXL14 | NP_689654.1 | Required for down-regulation of SNAI1 | 2..48 | ||
F-box-like | 5..46 | CDD:403981 | |||
AMN1 | 90..296 | CDD:187754 | 64/219 (29%) | ||
leucine-rich repeat | 92..118 | CDD:275381 | 7/25 (28%) | ||
leucine-rich repeat | 119..142 | CDD:275381 | 6/22 (27%) | ||
LRR 1 | 144..163 | 8/18 (44%) | |||
leucine-rich repeat | 145..170 | CDD:275381 | 11/29 (38%) | ||
LRR 2 | 170..191 | 3/20 (15%) | |||
leucine-rich repeat | 171..203 | CDD:275381 | 5/31 (16%) | ||
LRR 3 | 203..225 | 8/22 (36%) | |||
leucine-rich repeat | 204..229 | CDD:275381 | 8/25 (32%) | ||
AMN1 | 228..401 | CDD:187754 | 43/149 (29%) | ||
LRR 4 | 229..250 | 9/27 (33%) | |||
leucine-rich repeat | 230..254 | CDD:275381 | 10/30 (33%) | ||
LRR 5 | 254..275 | 9/21 (43%) | |||
leucine-rich repeat | 255..280 | CDD:275381 | 10/25 (40%) | ||
leucine-rich repeat | 281..306 | CDD:275381 | 3/24 (13%) | ||
leucine-rich repeat | 307..331 | CDD:275381 | 6/24 (25%) | ||
leucine-rich repeat | 332..357 | CDD:275381 | 8/24 (33%) | ||
leucine-rich repeat | 358..382 | CDD:275381 | 3/10 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1947 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |