DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and FBXL14

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:NP_689654.1 Gene:FBXL14 / 144699 HGNCID:28624 Length:418 Species:Homo sapiens


Alignment Length:307 Identity:84/307 - (27%)
Similarity:147/307 - (47%) Gaps:29/307 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 LVLLEAVLRAVPESAPIRQLDLTGMLSLTNELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQ 379
            |.|..::...:...|.|..|:|:|..:||:..|.:...:...:|:.|:|..|.|:..:.:..:.|
Human    76 LSLRRSLSYVIQGMANIESLNLSGCYNLTDNGLGHAFVQEIGSLRALNLSLCKQITDSSLGRIAQ 140

  Fly   380 LSGRLEALTMAYCRELTGTGLLQGLAGDINYSLQEL---------HLEETIFLDESSMCQ-LLER 434
            ....||.|.:..|..:|.||||.     |.:.||.|         ||.:......:.|.: ..|.
Human   141 YLKGLEVLELGGCSNITNTGLLL-----IAWGLQRLKSLNLRSCRHLSDVGIGHLAGMTRSAAEG 200

  Fly   435 LPNLRRLSLDNCRQAVTDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKE 499
            ...|.:|:|.:| |.:||.::..|.:..|.||.||:.:|..|:|.||:       .:|.:..|:.
Human   201 CLGLEQLTLQDC-QKLTDLSLKHISRGLTGLRLLNLSFCGGISDAGLL-------HLSHMGSLRS 257

  Fly   500 LNLRGCRNVTDSSLMVGLKLPELR--ALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDE 562
            ||||.|.|::|:.:| .|.:..||  .|.:.:|:::..:....:.|....|::|.:.|| .:.|:
Human   258 LNLRSCDNISDTGIM-HLAMGSLRLSGLDVSFCDKVGDQSLAYIAQGLDGLKSLSLCSC-HISDD 320

  Fly   563 TVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNL--VQLIACS 607
            .:..:|..:..||.||:..|.::|.:.:..|..|...|  :.|..|:
Human   321 GINRMVRQMHGLRTLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCT 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381
LRR_RI <297..482 CDD:238064 50/176 (28%)
leucine-rich repeat 304..330 CDD:275381 2/14 (14%)
leucine-rich repeat 331..357 CDD:275381 7/25 (28%)
leucine-rich repeat 358..379 CDD:275381 5/20 (25%)
leucine-rich repeat 384..409 CDD:275381 9/24 (38%)
leucine-rich repeat 412..437 CDD:275381 7/34 (21%)
AMN1 430..595 CDD:187754 48/167 (29%)
leucine-rich repeat 438..464 CDD:275381 8/25 (32%)
leucine-rich repeat 465..496 CDD:275381 10/30 (33%)
leucine-rich repeat 497..521 CDD:275381 10/23 (43%)
leucine-rich repeat 522..547 CDD:275381 5/26 (19%)
leucine-rich repeat 548..573 CDD:275381 6/24 (25%)
leucine-rich repeat 574..599 CDD:275381 8/24 (33%)
FBXL14NP_689654.1 Required for down-regulation of SNAI1 2..48
F-box-like 5..46 CDD:403981
AMN1 90..296 CDD:187754 64/219 (29%)
leucine-rich repeat 92..118 CDD:275381 7/25 (28%)
leucine-rich repeat 119..142 CDD:275381 6/22 (27%)
LRR 1 144..163 8/18 (44%)
leucine-rich repeat 145..170 CDD:275381 11/29 (38%)
LRR 2 170..191 3/20 (15%)
leucine-rich repeat 171..203 CDD:275381 5/31 (16%)
LRR 3 203..225 8/22 (36%)
leucine-rich repeat 204..229 CDD:275381 8/25 (32%)
AMN1 228..401 CDD:187754 43/149 (29%)
LRR 4 229..250 9/27 (33%)
leucine-rich repeat 230..254 CDD:275381 10/30 (33%)
LRR 5 254..275 9/21 (43%)
leucine-rich repeat 255..280 CDD:275381 10/25 (40%)
leucine-rich repeat 281..306 CDD:275381 3/24 (13%)
leucine-rich repeat 307..331 CDD:275381 6/24 (25%)
leucine-rich repeat 332..357 CDD:275381 8/24 (33%)
leucine-rich repeat 358..382 CDD:275381 3/10 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.