DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and fbxl4

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:XP_031761765.1 Gene:fbxl4 / 100490265 XenbaseID:XB-GENE-961513 Length:622 Species:Xenopus tropicalis


Alignment Length:533 Identity:117/533 - (21%)
Similarity:198/533 - (37%) Gaps:130/533 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 HNLEAIHKH------AKGGNCYLSFERIELR------------NLRQCRQLENFLRLVGHEVKHL 171
            |.||..|..      |...|.|......|:|            |..|.||....|:.:......|
 Frog   143 HILETYHPGSVVKILACSANPYSQSAPAEIRWETIWSGEPTRVNSPQSRQFTPCLKEISFPTNLL 207

  Fly   172 QVRH----APVFRNLDG-------KLPNLKVLTIATTMSMDDQHLAAMDDLDMKQFSHLVGFECD 225
            ::..    ...:..||.       :.|.|.:.|.|..||..|      ||.|.|          |
 Frog   208 RLETNSSLLDYYTELDAVELHGVKEKPVLFLKTAAIDMSDLD------DDYDDK----------D 256

  Fly   226 GVSLDAVLKMRMLLQLRRTENKVQLRHLQFEFRRNNENALLDVLQDH---------AETLVCVNL 281
            ...||::........:|...|......|.:|        |:..:..|         |:|  |..:
 Frog   257 SCELDSLTNQLSNTGIREWTNNGYFDKLPYE--------LIQFIISHLALPDLCRLAQT--CKLM 311

  Fly   282 FFSCSPGIDTREWCRAFENMHNLRTLKLS---GNCHLVLLEAVLRAVPESAPIRQLDLT-----G 338
            :..|         |...:..|    |.|.   .|.:...||.:|   |..:.::.|:|:     |
 Frog   312 YQHC---------CDPLQYTH----LSLQPYWTNVNDNSLEYLL---PRCSLVQWLNLSWTGNRG 360

  Fly   339 MLSLTN-ELLLYVAGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTGL-- 400
            ::|.:. ..||.|.|   |.|..|:|.....||..|::.:.::...|:.|.::.|.:|.....  
 Frog   361 LISTSGFSRLLKVCG---SELVRLELACGHFLNEACLEVIAEMCPNLQELNLSSCDKLPPQAFSH 422

  Fly   401 ---LQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQAVTDRTMATI---- 458
               |.||...:.|..:   :|:|..|...:.|      |.::.|:|.:|........:|::    
 Frog   423 ICKLSGLKRLVLYRTK---IEQTALLSILNFC------PEIQHLNLGSCVLIEDYDLVASVLGAK 478

  Fly   459 CQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRG----LKELNLRGCRNVTDSS---LMVG 516
            |:   :||:|::..|..||::|          |:.|..    |:||:|..|..:..|:   :.:.
 Frog   479 CK---KLRSLDLWRCKNITERG----------IAELASGCLLLEELDLGWCPTLQSSTGCFVNLA 530

  Fly   517 LKLPELRALSLGYCNRLTSEGFEALTQNCPSLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSN 581
            .|||.||.|.|.....:.....|.|.:||..|:.|.:.....|....:..::...|.|.:|::|.
 Frog   531 SKLPNLRKLFLTANRSVCDSDIEELARNCQHLQQLDILGTRMVSPAALCKLLECCKELFLLDVSF 595

  Fly   582 CTKLTLQSIHHIL 594
            |:::..:.:..::
 Frog   596 CSQIDSRVVQELV 608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040
leucine-rich repeat 281..303 CDD:275381 2/21 (10%)
LRR_RI <297..482 CDD:238064 48/202 (24%)
leucine-rich repeat 304..330 CDD:275381 7/28 (25%)
leucine-rich repeat 331..357 CDD:275381 8/31 (26%)
leucine-rich repeat 358..379 CDD:275381 6/20 (30%)
leucine-rich repeat 384..409 CDD:275381 7/29 (24%)
leucine-rich repeat 412..437 CDD:275381 4/24 (17%)
AMN1 430..595 CDD:187754 40/176 (23%)
leucine-rich repeat 438..464 CDD:275381 5/29 (17%)
leucine-rich repeat 465..496 CDD:275381 9/30 (30%)
leucine-rich repeat 497..521 CDD:275381 8/26 (31%)
leucine-rich repeat 522..547 CDD:275381 8/24 (33%)
leucine-rich repeat 548..573 CDD:275381 3/24 (13%)
leucine-rich repeat 574..599 CDD:275381 4/21 (19%)
fbxl4XP_031761765.1 F-box-like 281..325 CDD:403981 10/66 (15%)
leucine-rich repeat 296..318 CDD:275381 5/32 (16%)
leucine-rich repeat 319..341 CDD:275381 6/25 (24%)
leucine-rich repeat 348..377 CDD:275381 8/31 (26%)
leucine-rich repeat 378..403 CDD:275381 6/24 (25%)
leucine-rich repeat 404..428 CDD:275381 5/23 (22%)
AMN1 427..606 CDD:187754 47/200 (24%)
leucine-rich repeat 429..453 CDD:275381 6/32 (19%)
leucine-rich repeat 454..481 CDD:275381 5/29 (17%)
leucine-rich repeat 482..507 CDD:275381 9/34 (26%)
leucine-rich repeat 508..535 CDD:275381 8/26 (31%)
leucine-rich repeat 536..561 CDD:275381 8/24 (33%)
leucine-rich repeat 562..587 CDD:275381 3/24 (13%)
leucine-rich repeat 588..613 CDD:275381 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.