DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12402 and si:ch73-173p19.1

DIOPT Version :9

Sequence 1:NP_001303481.1 Gene:CG12402 / 41714 FlyBaseID:FBgn0038202 Length:671 Species:Drosophila melanogaster
Sequence 2:XP_002660968.3 Gene:si:ch73-173p19.1 / 100332407 ZFINID:ZDB-GENE-130530-952 Length:918 Species:Danio rerio


Alignment Length:773 Identity:164/773 - (21%)
Similarity:285/773 - (36%) Gaps:221/773 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KRLFE-RLSCSYAQTPNRMELNLNPLLAIARSIAAPPTP--PPTP-------EKLDSDKDKEGSS 71
            ||..| .|:||.      ..|.|.|..|:......|.||  ||:|       |:.:::..:|..:
Zfish   235 KRFGETELTCSL------RSLGLTPNAALCIQTTPPETPQDPPSPAPRLAVVEQPEAEPQEEPIA 293

  Fly    72 KAAIEL-----------LPNEMWLEIMSYLSYNDL------------LQLRMVSWRCRDLVHRRR 113
            ...:|.           ||:::|.|.:.|.....:            ...::|.....|..|...
Zfish   294 PPQVEAGALEEQEVPPPLPHQLWEEAVGYAGIPGVGPPLSGPSHFWGRGQKLVQGDAEDEEHLEN 358

  Fly   114 FMEKGKVIVTQHNLEAI-------HKHAKGGNCYLSFERIELRN--------LRQCR-------- 155
            ..::.:.:|...|.|.:       ...|:||        ::||:        ||:..        
Zfish   359 EEQQEEEVVPPFNFEGLPRLPFFMENRARGG--------LDLRHHWPEQGNRLREVEPDDPADPD 415

  Fly   156 ------------QLENFLRLVGHEVKH-LQVRHAP---VFRNLDGKLPNLKVLTIATTMSMDDQH 204
                        .:|...|...|:.:| ...:.:|   .|:.  .::|:|..:....|:|:    
Zfish   416 EGRALRGAAGQAAVERLQRGAHHDEQHSTHGQPSPPKKPFKT--PRVPSLCSMATRATVSL---- 474

  Fly   205 LAAMDDLDMKQFSHLVGFECDGVSLDAVLKMRMLLQLRRTENKVQLRHLQFEFRRNNENALLDVL 269
               |....|:..|.|.   |    |...|...:|..:.| |..::.|.|:               
Zfish   475 ---MTAPSMQYSSSLA---C----LTPELAELLLSHMAR-ERLLRPRTLE--------------- 513

  Fly   270 QDHAETLVCVNLFFSCSPGIDTREW---CRAFENMHNLRTLKLSGNC--HL------VLLEAVLR 323
                       |||.|    ..:::   |..:.....||.|: :..|  ||      ::.:|.|.
Zfish   514 -----------LFFGC----PLQKFVLNCYPYTTNELLRQLR-AFTCLKHLSFLNSPLITDAGLS 562

  Fly   324 AVPESAPIRQLDLTGMLSLTNELLLYVAGKWQSTLKVLD--------LMFCVQLNANCIDALRQL 380
            .:...:.::.|:|:....||:..|.::.|....|...||        |:..:|..::   ||.||
Zfish   563 VLSNLSKLQHLNLSSCSKLTDSCLQHITGLRSLTFLALDQTKVSDAGLLLYLQSGSS---ALCQL 624

  Fly   381 SGRLEALTMAYCRELTGT-------GLLQGLAGDIN-----YSLQELHLEETIFLDESSMCQLLE 433
            |....|:|.:..|.|..:       .:......|::     .:||.|||:.|...:.|..|  |.
Zfish   625 SLNQTAITESTLRVLPASVPQLRMLSIKHTKVSDVSALAELKNLQTLHLDGTGVQENSLQC--LA 687

  Fly   434 RLPNLRRLSLDNC------------------------RQAVTDRTMATICQYQTRLRNLNIEYCM 474
            ..|:|..|||...                        |.:|||..::.:.: ||.|..|::....
Zfish   688 SHPSLSALSLAGIPVADGNHTLEIIAGLRLTQLTLPGRHSVTDSGLSFLSR-QTLLLELDLTDYT 751

  Fly   475 KITDQGLMGYGDTPYPISRLRGLKELNLRGCRNVTDSSLMVGLKLPELRALSLGYCNRLTSEGFE 539
            ::||.|:.       .:|.:..||:|:|...: |:||.|...::|.||:.|.|.. ..:||.|..
Zfish   752 QLTDHGIT-------QLSSMTRLKKLSLSNTQ-VSDSGLQGLIRLKELQELCLDR-TAVTSRGVA 807

  Fly   540 ALTQNCPSLEALCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNLVQLI 604
            ||..:.|.|:.:.::|.. |.|..:...:.:..:|..||||. |::|.|.:..:..     :||.
Zfish   808 ALITHLPHLQVMGLASTQ-VGDTVIRRGLVHCPQLLKLNLSR-TRITDQGLKFLCR-----MQLS 865

  Fly   605 ACSIDGMDHEQAQ-RILESQRPQMKQVLLXQERYIHXRSRNTPHHNDWGNHEDDEFDD 661
            ..::||....... ..|.|..|.:..|     |..|.|:......:|    :||::::
Zfish   866 QVNLDGTGVTLVGIANLISACPHLSSV-----RASHTRAIPPDQQSD----DDDDYNN 914

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12402NP_001303481.1 F-box 75..117 CDD:279040 9/64 (14%)
leucine-rich repeat 281..303 CDD:275381 5/24 (21%)
LRR_RI <297..482 CDD:238064 54/236 (23%)
leucine-rich repeat 304..330 CDD:275381 8/33 (24%)
leucine-rich repeat 331..357 CDD:275381 6/25 (24%)
leucine-rich repeat 358..379 CDD:275381 6/28 (21%)
leucine-rich repeat 384..409 CDD:275381 5/31 (16%)
leucine-rich repeat 412..437 CDD:275381 9/24 (38%)
AMN1 430..595 CDD:187754 49/188 (26%)
leucine-rich repeat 438..464 CDD:275381 9/49 (18%)
leucine-rich repeat 465..496 CDD:275381 6/30 (20%)
leucine-rich repeat 497..521 CDD:275381 9/23 (39%)
leucine-rich repeat 522..547 CDD:275381 8/24 (33%)
leucine-rich repeat 548..573 CDD:275381 4/24 (17%)
leucine-rich repeat 574..599 CDD:275381 8/24 (33%)
si:ch73-173p19.1XP_002660968.3 UBA_like_SF 6..43 CDD:304366
Nop25 116..>169 CDD:286843
UBQ 187..260 CDD:294102 10/30 (33%)
AMN1 523..701 CDD:187754 44/183 (24%)
LRR <524..710 CDD:227223 44/191 (23%)
leucine-rich repeat 545..569 CDD:275381 4/23 (17%)
leucine-rich repeat 570..594 CDD:275381 6/23 (26%)
leucine-rich repeat 595..620 CDD:275381 5/27 (19%)
leucine-rich repeat 621..645 CDD:275381 8/23 (35%)
leucine-rich repeat 646..691 CDD:275381 10/46 (22%)
leucine-rich repeat 692..766 CDD:275381 16/81 (20%)
leucine-rich repeat 717..742 CDD:275381 6/25 (24%)
AMN1 750..>888 CDD:187754 41/153 (27%)
leucine-rich repeat 767..790 CDD:275381 9/23 (39%)
leucine-rich repeat 791..815 CDD:275381 8/24 (33%)
leucine-rich repeat 816..840 CDD:275381 4/24 (17%)
leucine-rich repeat 841..863 CDD:275381 8/27 (30%)
leucine-rich repeat 864..888 CDD:275381 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.