DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK1-R and CCHa2-R

DIOPT Version :9

Sequence 1:NP_001014620.1 Gene:PK1-R / 41713 FlyBaseID:FBgn0038201 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001356958.1 Gene:CCHa2-R / 35535 FlyBaseID:FBgn0033058 Length:501 Species:Drosophila melanogaster


Alignment Length:406 Identity:102/406 - (25%)
Similarity:173/406 - (42%) Gaps:103/406 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAGNMSHDLG---------PPRDPLAI-----------VIP------------VTVVYSLIFITG 34
            |.||.::|.|         ..::.||:           ::|            |||:|:||||.|
  Fly    19 SDGNGANDSGLLATGQGLEQEQEGLALDMGHNASADGGIVPYVPVLDRPETYIVTVLYTLIFIVG 83

  Fly    35 VVGNISTCIVIKKNRSMHTATNYYLFSLAISDFLLLLSGVPQEVSYIWSKYPYVFGEYICIGRGL 99
            |:||.:..|:..::|||....|.|:.|||::|.|::|..|| ..:.::::..:.|...:|.....
  Fly    84 VLGNGTLVIIFFRHRSMRNIPNTYILSLALADLLVILVCVP-VATIVYTQESWPFERNMCRISEF 147

  Fly   100 LAETSANATVLTITAFTVERYIAICHPFLGQAMSKLSR---AIRIIVLVWIMAIVTAIPQAAQFG 161
            ..:.|...:|.|:||.:.|||.||.:|     :.||..   .:...|::||:||:..:|......
  Fly   148 FKDISIGVSVFTLTALSGERYCAIVNP-----LRKLQTKPLTVFTAVMIWILAILLGMPSVLFSD 207

  Fly   162 IEHY-----SG---VEQCGIVRVIVKHSFQLS--TFIFFLAPMSIILVLYLLIGVHLYRSTLVEG 216
            |:.|     :|   :|.|...|......|.::  ..:::|.|:|||..||:::...|:.|.    
  Fly   208 IKSYPVFTATGNMTIEVCSPFRDPEYAKFMVAGKALVYYLLPLSIIGALYIMMAKRLHMSA---- 268

  Fly   217 PASVARRQQLKSVPSDTILYRYGGSGTAMSFNGGGSGAGTAGLMGGSGAQLSSVRGRLNHYGTRR 281
                      :::|.:.                                  .|::.|........
  Fly   269 ----------RNMPGEQ----------------------------------QSMQSRTQARARLH 289

  Fly   282 VLRMLVAVVVCFFLCWAPFHAQRLIAIYAPARGAKLRDQHEFVYTVMTYVSGVLYYLSTCINPLL 346
            |.||:||.||.||:|:.|:|...|...:.|...   .|..|| :.|:..|.....:|::|:||:.
  Fly   290 VARMVVAFVVVFFICFFPYHVFELWYHFYPTAE---EDFDEF-WNVLRIVGFCTSFLNSCVNPVA 350

  Fly   347 YNIMSHKFREAFKAVL 362
            ...:|..||:.|...|
  Fly   351 LYCVSGVFRQHFNRYL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK1-RNP_001014620.1 7tmA_capaR 21..358 CDD:320262 93/361 (26%)
TM helix 1 21..48 CDD:320262 14/38 (37%)
TM helix 2 55..81 CDD:320262 10/25 (40%)
TM helix 3 94..124 CDD:320262 10/29 (34%)
TM helix 4 136..158 CDD:320262 6/24 (25%)
TM helix 5 178..207 CDD:320262 8/30 (27%)
TM helix 6 277..307 CDD:320262 13/29 (45%)
TM helix 7 326..351 CDD:320262 6/24 (25%)
CCHa2-RNP_001356958.1 7tmA_Bombesin_R-like 70..362 CDD:320593 92/349 (26%)
TM helix 1 71..97 CDD:320593 13/25 (52%)
TM helix 2 104..130 CDD:320593 10/26 (38%)
TM helix 3 142..172 CDD:320593 10/29 (34%)
TM helix 4 182..202 CDD:320593 5/19 (26%)
TM helix 5 234..259 CDD:320593 8/24 (33%)
TM helix 6 285..315 CDD:320593 13/29 (45%)
TM helix 7 330..355 CDD:320593 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438996
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.