DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK1-R and MLNR

DIOPT Version :9

Sequence 1:NP_001014620.1 Gene:PK1-R / 41713 FlyBaseID:FBgn0038201 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001498.1 Gene:MLNR / 2862 HGNCID:4495 Length:412 Species:Homo sapiens


Alignment Length:429 Identity:119/429 - (27%)
Similarity:181/429 - (42%) Gaps:130/429 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PPRD-------PLAIVIPVTVVYSLIFITGVVGNISTCIVIKKNRSMHTATNYYLFSLAISDFLL 69
            ||.|       ||..::|||.|...:|:.||.||:.|.::|.:.|.|.|.||.||.|:|:||.|:
Human    23 PPCDERRCSPFPLGALVPVTAVCLCLFVVGVSGNVVTVMLIGRYRDMRTTTNLYLGSMAVSDLLI 87

  Fly    70 LLSGVPQEVSYIWSKYPYVFGEYICIGRGLLAETSANATVLTITAFTVERYIAICHPFLGQAMSK 134
            || |:|.::..:|...|:|||..:|.....:.|....||:|.:||.:||||:|||.|...:.:..
Human    88 LL-GLPFDLYRLWRSRPWVFGPLLCRLSLYVGEGCTYATLLHMTALSVERYLAICRPLRARVLVT 151

  Fly   135 LSRAIRIIVLVWIMAIVTAIPQAAQFGIEHYSGVE------------------------------ 169
            ..|...:|.::|.:|:::|.|.....|:|...|:.                              
Human   152 RRRVRALIAVLWAVALLSAGPFLFLVGVEQDPGISVVPGLNGTARIASSPLASSPPLWLSRAPPP 216

  Fly   170 ------------------------QCGIVRVIVKHSFQLSTFIFFLAPMSIILVLYLLIGVHLYR 210
                                    |.|.:||::    .::|..||| |...:.:||.|||..|:.
Human   217 SPPSGPETAEAAALFSRECRPSPAQLGALRVML----WVTTAYFFL-PFLCLSILYGLIGRELWS 276

  Fly   211 STL-VEGPASVARRQQLKSVPSDTILYRYGGSGTAMSFNGGGSGAGTAGLMGGSGAQLSSVRGRL 274
            |.. :.|||:..|.:                                                  
Human   277 SRRPLRGPAASGRER-------------------------------------------------- 291

  Fly   275 NHYGTRRVLRMLVAVVVCFFLCWAPFHAQRLIAIYAPARGAKLRDQHEFVYT-VMTYVSGVLYYL 338
               |.|:.:|:|:.||:.|.:||.|||..|:|.|       ...|.....:: ....|:..|:||
Human   292 ---GHRQTVRVLLVVVLAFIICWLPFHVGRIIYI-------NTEDSRMMYFSQYFNIVALQLFYL 346

  Fly   339 STCINPLLYNIMSHKFR-EAFKAVLFGKKVSKGSLNSRN 376
            |..|||:|||::|.|:| .|||.:|..|...:|...||:
Human   347 SASINPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRD 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK1-RNP_001014620.1 7tmA_capaR 21..358 CDD:320262 106/393 (27%)
TM helix 1 21..48 CDD:320262 11/26 (42%)
TM helix 2 55..81 CDD:320262 13/25 (52%)
TM helix 3 94..124 CDD:320262 12/29 (41%)
TM helix 4 136..158 CDD:320262 6/21 (29%)
TM helix 5 178..207 CDD:320262 10/28 (36%)
TM helix 6 277..307 CDD:320262 13/29 (45%)
TM helix 7 326..351 CDD:320262 11/25 (44%)
MLNRNP_001498.1 7tm_1 55..355 CDD:278431 93/365 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380940at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.