DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PK1-R and Cckbr

DIOPT Version :9

Sequence 1:NP_001014620.1 Gene:PK1-R / 41713 FlyBaseID:FBgn0038201 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_031653.1 Gene:Cckbr / 12426 MGIID:99479 Length:453 Species:Mus musculus


Alignment Length:411 Identity:109/411 - (26%)
Similarity:170/411 - (41%) Gaps:92/411 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAGNMSHDL----GPPRDPLAIVIPVTVVYSLIFITGVVGNISTCIVIKKNRSMHTATNYYLFSL 62
            ||||:|.:.    |.....|.:.|.:| :|::||:..|.||:...:|:..:|.:.|.||.:|.||
Mouse    33 SAGNLSCETPRIRGTGTRELELTIRIT-LYAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSL 96

  Fly    63 AISDFLLLLSGVPQEVSYIWSKYP-----YVFGEYICIGRGLLAETSANATVLTITAFTVERYIA 122
            |:||.||.::.:|      ::..|     ::||..||.....|...|.:.:.|.:.|..:|||.|
Mouse    97 AVSDLLLAVACMP------FTLLPNLMGTFIFGTVICKAVSYLMGVSVSVSTLNLAAIALERYSA 155

  Fly   123 ICHPFLGQAMSKLSRAIRIIVLVWIMAIVTAIPQAAQFGIEHYSGVEQCG-----------IVRV 176
            ||.|...:.....|.|.|:|:..|:::.:..:|...      |:.|:..|           ..||
Mouse   156 ICRPLQARVWQTRSHAARVILATWLLSGLLMVPYPV------YTVVQPVGPRILQCMHLWPSERV 214

  Fly   177 IVKHSFQLSTFIFFLAPMSIILVLYLLIGVHLYRSTLVEGPASVARRQQLKSVPSDTILYRYGGS 241
            ....|..|...:||: |..::.|.|.||...||.....:|......:.::::         .|| 
Mouse   215 QQMWSVLLLILLFFI-PGVVMAVAYGLISRELYLGLRFDGDNDSETQSRVRN---------QGG- 268

  Fly   242 GTAMSFNGGGSGAGTAGLMGG------------SGAQLSSVRGRLNH------------------ 276
                 ..||.:..|.....||            .|..:...|.||..                  
Mouse   269 -----LPGGAAAPGPVHQNGGCRHVTSLTGEDSDGCYVQLPRSRLEMTTLTTPTTGPGPGPRPNQ 328

  Fly   277 ---YGTRRVLRMLVAVVVCFFLCWAP-FHAQRLIAIYAP-ARGAKLRDQHEFVYTVMTYVSGVLY 336
               ...:||:|||:.:|:.||:||.| :.|....|...| ||.|.......|::        :|.
Mouse   329 AKLLAKKRVVRMLLVIVLLFFVCWLPVYSANTWRAFDGPGARRALAGAPISFIH--------LLS 385

  Fly   337 YLSTCINPLLYNIMSHKFREA 357
            |.|.|.|||:|..|..:||:|
Mouse   386 YTSACANPLVYCFMHRRFRQA 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PK1-RNP_001014620.1 7tmA_capaR 21..358 CDD:320262 102/388 (26%)
TM helix 1 21..48 CDD:320262 9/26 (35%)
TM helix 2 55..81 CDD:320262 11/25 (44%)
TM helix 3 94..124 CDD:320262 9/29 (31%)
TM helix 4 136..158 CDD:320262 6/21 (29%)
TM helix 5 178..207 CDD:320262 9/28 (32%)
TM helix 6 277..307 CDD:320262 12/30 (40%)
TM helix 7 326..351 CDD:320262 8/24 (33%)
CckbrNP_031653.1 7tm_4 60..>191 CDD:304433 42/136 (31%)
7tm_1 71..396 CDD:278431 91/360 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..276 4/33 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24243
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.