DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9920 and CPN10

DIOPT Version :9

Sequence 1:NP_650333.1 Gene:CG9920 / 41712 FlyBaseID:FBgn0038200 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_563961.1 Gene:CPN10 / 838063 AraportID:AT1G14980 Length:98 Species:Arabidopsis thaliana


Alignment Length:98 Identity:49/98 - (50%)
Similarity:66/98 - (67%) Gaps:3/98 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VIKKVIPMLDRILIQRFEVKTTTAGGILLPEESVPKEMQGVVVAVGPGARNPAGAGHLSVGVKEG 68
            ::|::||..:|||:||......|..||||||:| .|...|.|:|||||:|:..|. .:.|.||||
plant     1 MMKRLIPTFNRILVQRVIQPAKTESGILLPEKS-SKLNSGKVIAVGPGSRDKDGK-LIPVSVKEG 63

  Fly    69 DRVLLPKYGGTKVDMDDKREYVLFRESDILAKL 101
            |.||||:||||:|.:.: .||.|||:.|:|..|
plant    64 DTVLLPEYGGTQVKLGE-NEYHLFRDEDVLGTL 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9920NP_650333.1 Cpn10 7..101 CDD:197951 47/93 (51%)
CPN10NP_563961.1 cpn10 4..95 CDD:238197 47/93 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 90 1.000 Domainoid score I2659
eggNOG 1 0.900 - - E1_COG0234
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I2236
OMA 1 1.010 - - QHG61845
OrthoDB 1 1.010 - - D1580867at2759
OrthoFinder 1 1.000 - - FOG0002235
OrthoInspector 1 1.000 - - mtm1197
orthoMCL 1 0.900 - - OOG6_100490
Panther 1 1.100 - - O PTHR10772
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1667
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.