DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9920 and CPN20

DIOPT Version :9

Sequence 1:NP_650333.1 Gene:CG9920 / 41712 FlyBaseID:FBgn0038200 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001318614.1 Gene:CPN20 / 832195 AraportID:AT5G20720 Length:253 Species:Arabidopsis thaliana


Alignment Length:93 Identity:35/93 - (37%)
Similarity:53/93 - (56%) Gaps:3/93 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PMLDRILIQRFEVKTTTAGGILLPEESVPKEMQGVVVAVGPGARNPAGAGHLSVGVKEGDRVLLP 74
            |:.||:|::..|.:..|.||||||..:..|...|.|||||.|  ...|...:.:.|..|.:::..
plant    64 PLGDRVLVKIKEAEEKTLGGILLPSTAQSKPQGGEVVAVGEG--RTIGKNKIDITVPTGAQIIYS 126

  Fly    75 KYGGTKVDMDDKREYVLFRESDILAKLE 102
            ||.||:|:.:|.:..:| :|.||:..||
plant   127 KYAGTEVEFNDVKHLIL-KEDDIVGILE 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9920NP_650333.1 Cpn10 7..101 CDD:197951 33/90 (37%)
CPN20NP_001318614.1 groES 61..153 CDD:178988 33/91 (36%)
groES 160..252 CDD:178988
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0234
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100490
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.670

Return to query results.
Submit another query.