DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9920 and hspe1

DIOPT Version :9

Sequence 1:NP_650333.1 Gene:CG9920 / 41712 FlyBaseID:FBgn0038200 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_012825769.1 Gene:hspe1 / 448701 XenbaseID:XB-GENE-963412 Length:107 Species:Xenopus tropicalis


Alignment Length:95 Identity:51/95 - (53%)
Similarity:67/95 - (70%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKVIPMLDRILIQRFEVKTTTAGGILLPEESVPKEMQGVVVAVGPGARNPAGAGHLSVGVKEGDR 70
            ||.:|:.||:|::|...:|.|.|||:|||:|..|.:|..|||||.|:|...| ....|.||.|::
 Frog    12 KKFVPLFDRVLVERLAAETVTKGGIMLPEKSQGKVLQATVVAVGDGSRGKTG-DIQPVSVKVGEK 75

  Fly    71 VLLPKYGGTKVDMDDKREYVLFRESDILAK 100
            :|||:||||||.:||| ||.|||:.|||.|
 Frog    76 ILLPEYGGTKVVLDDK-EYFLFRDGDILGK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9920NP_650333.1 Cpn10 7..101 CDD:197951 50/94 (53%)
hspe1XP_012825769.1 cpn10 13..105 CDD:238197 50/94 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6347
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I4731
OMA 1 1.010 - - QHG61845
OrthoDB 1 1.010 - - D1580867at2759
OrthoFinder 1 1.000 - - FOG0002235
OrthoInspector 1 1.000 - - otm47898
Panther 1 1.100 - - O PTHR10772
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R196
SonicParanoid 1 1.000 - - X1667
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.