DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9920 and Hspe1

DIOPT Version :9

Sequence 1:NP_650333.1 Gene:CG9920 / 41712 FlyBaseID:FBgn0038200 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_037098.1 Gene:Hspe1 / 25462 RGDID:2844 Length:102 Species:Rattus norvegicus


Alignment Length:95 Identity:49/95 - (51%)
Similarity:66/95 - (69%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKVIPMLDRILIQRFEVKTTTAGGILLPEESVPKEMQGVVVAVGPGARNPAGAGHLSVGVKEGDR 70
            :|.:|:.||:|::|...:|.|.|||:|||:|..|.:|..|||||.|.:...|... .|.||.||:
  Rat     7 RKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGGKGKGGEIQ-PVSVKVGDK 70

  Fly    71 VLLPKYGGTKVDMDDKREYVLFRESDILAK 100
            ||||::|||||.:||| :|.|||:.|||.|
  Rat    71 VLLPEHGGTKVVLDDK-DYFLFRDGDILGK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9920NP_650333.1 Cpn10 7..101 CDD:197951 49/94 (52%)
Hspe1NP_037098.1 cpn10 8..100 CDD:238197 49/94 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337283
Domainoid 1 1.000 102 1.000 Domainoid score I6677
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I4837
OMA 1 1.010 - - QHG61845
OrthoDB 1 1.010 - - D1580867at2759
OrthoFinder 1 1.000 - - FOG0002235
OrthoInspector 1 1.000 - - mtm9016
orthoMCL 1 0.900 - - OOG6_100490
Panther 1 1.100 - - O PTHR10772
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1667
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.