DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9920 and hsp10

DIOPT Version :9

Sequence 1:NP_650333.1 Gene:CG9920 / 41712 FlyBaseID:FBgn0038200 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_588098.1 Gene:hsp10 / 2539489 PomBaseID:SPCC550.06c Length:104 Species:Schizosaccharomyces pombe


Alignment Length:95 Identity:46/95 - (48%)
Similarity:64/95 - (67%) Gaps:4/95 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKVIPMLDRILIQRFEVKTTTAGGILLPEESVPKEMQGVVVAVGPGARNPAG-AGHLSVGVKEGD 69
            |.::|:|||||:||.:..|.||.||.|||:||.|..:|.|::||.|..|..| ....||.|  ||
pombe     9 KSIVPLLDRILVQRIKADTKTASGIFLPEKSVEKLSEGRVISVGKGGYNKEGKLAQPSVAV--GD 71

  Fly    70 RVLLPKYGGTKVDMDDKREYVLFRESDILA 99
            |||||.|||:.:.:.:: ||.|:|:.::||
pombe    72 RVLLPAYGGSNIKVGEE-EYSLYRDHELLA 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9920NP_650333.1 Cpn10 7..101 CDD:197951 45/94 (48%)
hsp10NP_588098.1 Cpn10 10..102 CDD:197951 45/94 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 82 1.000 Domainoid score I2276
eggNOG 1 0.900 - - E1_COG0234
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I1805
OMA 1 1.010 - - QHG61845
OrthoFinder 1 1.000 - - FOG0002235
OrthoInspector 1 1.000 - - otm47096
orthoMCL 1 0.900 - - OOG6_100490
Panther 1 1.100 - - O PTHR10772
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R196
SonicParanoid 1 1.000 - - X1667
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.