DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9920 and Y22D7AL.10

DIOPT Version :9

Sequence 1:NP_650333.1 Gene:CG9920 / 41712 FlyBaseID:FBgn0038200 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_497428.1 Gene:Y22D7AL.10 / 175315 WormBaseID:WBGene00021248 Length:108 Species:Caenorhabditis elegans


Alignment Length:97 Identity:51/97 - (52%)
Similarity:70/97 - (72%) Gaps:2/97 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SNVIKKVIPMLDRILIQRFEVKTTTAGGILLPEESVPKEMQGVVVAVGPGARNPAGAGHLSVGVK 66
            |||:|...|:.||:|::|...:|.|.|||:|||:|..|.::..||:.|.|.||..|. .:::.||
 Worm    10 SNVLKTFKPLYDRVLVERVAAETKTKGGIMLPEKSQGKVLEATVVSAGAGLRNEKGE-LVALTVK 73

  Fly    67 EGDRVLLPKYGGTKVDMDDKREYVLFRESDIL 98
            .|||||||:||||||.::|| ||.:|||||:|
 Worm    74 PGDRVLLPEYGGTKVVVEDK-EYSIFRESDLL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9920NP_650333.1 Cpn10 7..101 CDD:197951 47/92 (51%)
Y22D7AL.10NP_497428.1 Cpn10 15..107 CDD:197951 47/92 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157621
Domainoid 1 1.000 101 1.000 Domainoid score I4348
eggNOG 1 0.900 - - E1_COG0234
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 102 1.000 Inparanoid score I3553
Isobase 1 0.950 - 0 Normalized mean entropy S576
OMA 1 1.010 - - QHG61845
OrthoDB 1 1.010 - - D1580867at2759
OrthoFinder 1 1.000 - - FOG0002235
OrthoInspector 1 1.000 - - otm14763
orthoMCL 1 0.900 - - OOG6_100490
Panther 1 1.100 - - O PTHR10772
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R196
SonicParanoid 1 1.000 - - X1667
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.