DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9920 and HSPE1-MOB4

DIOPT Version :10

Sequence 1:NP_650333.1 Gene:CG9920 / 41712 FlyBaseID:FBgn0038200 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001189414.1 Gene:HSPE1-MOB4 / 100529241 HGNCID:49184 Length:261 Species:Homo sapiens


Alignment Length:48 Identity:23/48 - (47%)
Similarity:35/48 - (72%) Gaps:0/48 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKVIPMLDRILIQRFEVKTTTAGGILLPEESVPKEMQGVVVAVGPGAR 53
            :|.:|:.||:|::|...:|.|.|||:|||:|..|.:|..|||||.|::
Human     7 RKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSK 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9920NP_650333.1 Cpn10 7..101 CDD:197951 23/47 (49%)
HSPE1-MOB4NP_001189414.1 cpn10 8..>57 CDD:238197 23/47 (49%)
Mob1_phocein 89..243 CDD:461000
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.