powered by:
Protein Alignment Npc2b and AT1G45015
DIOPT Version :9
Sequence 1: | NP_650331.1 |
Gene: | Npc2b / 41710 |
FlyBaseID: | FBgn0038198 |
Length: | 159 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_683380.1 |
Gene: | AT1G45015 / 841067 |
AraportID: | AT1G45015 |
Length: | 153 |
Species: | Arabidopsis thaliana |
Alignment Length: | 44 |
Identity: | 9/44 - (20%) |
Similarity: | 16/44 - (36%) |
Gaps: | 12/44 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 LPFPGYYGTSACPHIYDEAGEKKVGCPLKAGQVYTYKNSFKILP 128
:||..|.....|. ||:.:|..:.:..|..::|
plant 80 IPFKYYDFCQLCK------------CPMLSGTNFVFTLSQILIP 111
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Npc2b | NP_650331.1 |
Npc2_like |
23..155 |
CDD:238458 |
9/44 (20%) |
AT1G45015 | NP_683380.1 |
ML |
27..140 |
CDD:412276 |
9/44 (20%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR11306 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.