DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Npc2b and AT3G11780

DIOPT Version :9

Sequence 1:NP_650331.1 Gene:Npc2b / 41710 FlyBaseID:FBgn0038198 Length:159 Species:Drosophila melanogaster
Sequence 2:NP_001189862.1 Gene:AT3G11780 / 820352 AraportID:AT3G11780 Length:171 Species:Arabidopsis thaliana


Alignment Length:134 Identity:27/134 - (20%)
Similarity:59/134 - (44%) Gaps:28/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSLGLFVIFAALIGFTSSTDVSQCPKSKSKALAAGDVSISNCPKSKCILKRNTEASIQMKIRPER 67
            |::..|::.:.::   ::|||..|..::...:....|.|:..|     :.|...|:.::....: 
plant    10 LAISYFLLVSTIV---AATDVHYCDNNEEYEVKVQGVDITPYP-----IARGEPATFRISANTD- 65

  Fly    68 DFQELTSDIQGIILDVPLPFPGYYGTSACPHIYDEAGE--KKVGCPLKAGQVYTYKNSFKILPVY 130
              .|::|.  .::::|     .|:|.    ||:.|..:  .:..||:..|......:  ::||.|
plant    66 --TEISSG--KLVIEV-----SYFGW----HIHSETHDLCDETSCPVAIGDFLVAHS--QVLPGY 115

  Fly   131 --PT 132
              ||
plant   116 TPPT 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Npc2bNP_650331.1 Npc2_like 23..155 CDD:238458 23/114 (20%)
AT3G11780NP_001189862.1 PG-PI_TP 27..160 CDD:238459 23/114 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11306
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.